SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183981628|ref|YP_001849919.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183981628|ref|YP_001849919.1|
Domain Number 1 Region: 27-153
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000381
Family HD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|183981628|ref|YP_001849919.1|
Sequence length 211
Comment hypothetical protein MMAR_1613 [Mycobacterium marinum M]
Sequence
MQSVPELVDTTVAQAALRLSRSTESPAVFNHSVRSYLFGELLAAHDGMRHGVDYDSQTLF
LGCVLHDLGAGSAAPGKARFEVEGADLAAALLGEHGCDNEVVDTVWEAIALHTCFGIAER
RGPICYLVHAGVGMDFGRNAEFVDDRTAALIHDQYPRLSMATTLVDAITTHAQRSPEAAP
PYTVPGGLLLERRTNGITALEQLESLGRWGE
Download sequence
Identical sequences A0A117DUH9 B2HHD2 L7V535
gi|183981628|ref|YP_001849919.1| WP_012393446.1.33562 WP_012393446.1.39490 WP_012393446.1.5386 WP_012393446.1.90902 gi|443490040|ref|YP_007368187.1| 216594.MMAR_1613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]