SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183983106|ref|YP_001851397.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183983106|ref|YP_001851397.1|
Domain Number 1 Region: 8-262
Classification Level Classification E-value
Superfamily Cgl1923-like 5.36e-88
Family Cgl1923-like 0.0000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|183983106|ref|YP_001851397.1|
Sequence length 292
Comment hypothetical protein MMAR_3107 [Mycobacterium marinum M]
Sequence
MTPSDASRELPELHKTVVVAAFEGWNDAGDAASDAVGHLAAIWNATPIVEIDDEAYYDYQ
VNRPVIRQIDGVTRELEWPAMRISHCRPPDSDRDVVLMCGLEPNMRWRTFCAELLAIIEK
LNVDTVVILGALLADTPHTRPVPVSGAAYSAESARVFGLEETRYEGPTGIAGVFQYACVA
AGIPAVTFWAAVPHYVSHPPNPKATVALLRRVEDVLDIEVPLSSLPAQAEVWEQEITEMT
SDDDELAEYVQTLEKHGDEAVEMNDALGKIDGDALAAEFERYLRRRRPGFGL
Download sequence
Identical sequences A0PQV2 B2HFX8 L7V9C3 X8FAG6
WP_011740337.1.20315 WP_011740337.1.28311 WP_011740337.1.33562 WP_011740337.1.48473 WP_011740337.1.5386 WP_011740337.1.90902 WP_011740337.1.91103 WP_011740337.1.92715 gi|443491428|ref|YP_007369575.1| gi|183983106|ref|YP_001851397.1| gi|118617860|ref|YP_906192.1| 216594.MMAR_3107 362242.MUL_2357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]