SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183982012|ref|YP_001850303.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183982012|ref|YP_001850303.1|
Domain Number 1 Region: 20-285
Classification Level Classification E-value
Superfamily Cgl1923-like 4.18e-87
Family Cgl1923-like 0.000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|183982012|ref|YP_001850303.1|
Sequence length 325
Comment hypothetical protein MMAR_1998 [Mycobacterium marinum M]
Sequence
MAHDQDPGEAQDYQPGQSGMYELEFPAPQLSTSDGRGPVLVHALEGFSDAGHAIRLAATH
LKDGLDTELVASFAIDELLDYRSRRPMMTFKTDHFTKYDDPELSLYALRDSVGTPFLLLA
GMEPDLKWERFITAVRLLAERLGVRQTIGLGTVPMAVPHTRPVTMTAHSNNPELIADFQP
WISEIQVPASASNLLEYRMAQHGHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTGSLD
LPLAALTDASAQVGAKIDEQVQASAEVAQVVAALERQYDAFIDAQENRSLLTRDEDLPSG
DELGAEFERFLAQQAEKKFDDDDQP
Download sequence
Identical sequences A0A117DZA1 B2HLY4
WP_012393783.1.28311 WP_012393783.1.33562 WP_012393783.1.39490 WP_012393783.1.48473 WP_012393783.1.90902 gi|183982012|ref|YP_001850303.1| 216594.MMAR_1998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]