SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170720979|ref|YP_001748667.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170720979|ref|YP_001748667.1|
Domain Number 1 Region: 485-658
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-35
Family Histidine kinase 0.0039
Further Details:      
 
Domain Number 2 Region: 681-792
Classification Level Classification E-value
Superfamily CheY-like 3.13e-26
Family CheY-related 0.016
Further Details:      
 
Domain Number 3 Region: 4-152
Classification Level Classification E-value
Superfamily CheY-like 9.25e-23
Family CheY-related 0.0028
Further Details:      
 
Domain Number 4 Region: 290-394
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000564
Family Heme-binding PAS domain 0.028
Further Details:      
 
Domain Number 5 Region: 130-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000593
Family Flavin-binding PAS domain 0.036
Further Details:      
 
Domain Number 6 Region: 414-492
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000131
Family Homodimeric domain of signal transducing histidine kinase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170720979|ref|YP_001748667.1|
Sequence length 795
Comment multi-sensor hybrid histidine kinase [Pseudomonas putida W619]
Sequence
MLPTPLKLLMVEDSSLDAELTLLSLERSGLQLQSQLVFDHVAAEHALGEARYDLILCDCV
LPGSSGTDVLAIAQRLAPDTPFIFLSGIYGEEHAVEMIRLGATDYVLKKNLPLLPKAVRR
ALTEVQERQRRRRAEEALADVEARARIAIDAAGMGTWDFRPEEGLLIWDDRCKTLFGLPV
DTEMSLDVFYDGIYPEDVPRVREAVEYAMRPDSDGLYRAEFRIAQPNGLEPRWLLSSGQS
QFVDGRCTRFSGVLQDIHTQRLATQALKQLNEMLGERVERRTRERDRAWELSQDLLAVLN
KDLTPVALNPAWEASLGFSRERLSQTSLLQLLPEPDQEALLTELAALAHGRTSARFVGRI
QHAGGQLRWLSWVVVPEDTLLYVVARDITSEREAAMGLADANDRLREQITERERIEAALQ
QMQRLEAVGQLTAGVAHDFNNLLTVILTGSSFLERDLDKGDLEKARKRLTHIREAGERGA
KLTSQLLAFSRRQRLEPVPLNLNRTLGGLEELLRRTLGGSISVRLDLDHSLWQALTDPTQ
TEMIILNLAINARDAMPDGGQLTLATRNTRIKARPQRPEDPEPGEYVMLSIRDTGCGMSE
EVVAKVFEPFFTTKDIGKGSGLGLAQVFGFAKQSGGGVRIDTAPGHGTQVAVYLPAVKHE
LAADPVIPAASQSISDSGRDRMVLLVDDDHLVRDMLGDVLRQYGYQVRQAHSGEQALAQL
DDEIDLLLTDFAMPEFNGAQLALAARERHPRLPVVFLTGYAELEGLDLPDSLVMQKPVQA
EELARVLDELLRVNR
Download sequence
Identical sequences B1J6D0
WP_012313695.1.83615 gi|170720979|ref|YP_001748667.1| 390235.PputW619_1794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]