SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170288540|ref|YP_001738778.1| from Thermotoga sp. RQ2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170288540|ref|YP_001738778.1|
Domain Number 1 Region: 269-532
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.24e-70
Family Tandem AAA-ATPase domain 0.000000000239
Further Details:      
 
Domain Number 2 Region: 92-264
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-55
Family RecG "wedge" domain 0.0000000227
Further Details:      
 
Domain Number 3 Region: 471-680
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.67e-43
Family Tandem AAA-ATPase domain 0.0000000539
Further Details:      
 
Domain Number 4 Region: 1-88
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 2.09e-33
Family RecG, N-terminal domain 0.00000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170288540|ref|YP_001738778.1|
Sequence length 763
Comment ATP-dependent DNA helicase RecG [Thermotoga sp. RQ2]
Sequence
MPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLENKDLEEKLQAFLDYVKEIPNLP
EARKRYRIQKSLEMIEKLRSWFLIDYLECSGEEVDLSTDIQYAKGVGPNRKKKLKKLGIE
TLRDLLEFFPRDYEDRRKIFKLNDLLPGEKVTTQGKIVSVETKRFQNMNILTAVLSDGLV
HVPLKWFNQEYLQTYLKQLTGKEVFVTGTVKSNAYTGQYEIHNAEVTPKEGEYVRRILPI
YRLTSGISQKQMRKIFEENIPSLCCSLKETLPERILEKRKLLGVKDAYYGMHFPKTFYHL
EKARERLAYEELFVLQLAFQKIRKEREKHGGIPKKIEGKLAEEFIKSLPFKLTNAQKRAH
QEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRT
VESFSKFNIHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTHALIQEDVHFKNLGLVIID
EQHRFGVKQREALMNKGKMVDTLVMSATPIPRSMALAFYGDLDVTVIDEMPPGRKEVQTM
LVPMDRVNEIYEFVRQEVMKGGQAFIVYPLIEESDKLNVKSAVEMYEYLSKEVFPEFKLG
LMHGRLSQEEKDRVMLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHQL
RGRVGRGGQEAYCFLVVGDVGEEAMERLRFFTLNTDGFKIAEYDLKTRGPGEFFGVKQHG
LSGFKVADLYRDLKLLEWAREDVQEIDVEGIELPEEIKLIEVG
Download sequence
Identical sequences A0A0F6AKQ6
gi|170288540|ref|YP_001738778.1| WP_012310719.1.32102 126740.TRQ2_0743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]