SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|512444360|ref|YP_008119639.1| from Treponema pallidum subsp. pallidum SS14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512444360|ref|YP_008119639.1|
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.13e-32
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|512444360|ref|YP_008119639.1|
Sequence length 105
Comment thioredoxin group 1 family protein [Treponema pallidum subsp. pallidum SS14]
Sequence
MALLDISSGNVRKTIETNPLVIVDFWAPWCGSCKMLGPVLEEVESEVGSGVVIGKLNVDD
DQDLAVEFNVASIPTLIVFKDGKEVDRSIGFVDKSKILTLIQKNA
Download sequence
Identical sequences A0A0A7XB66 A0A0H3BJZ1 H6KV31 O83889 R9UVS2
243276.TP0919 455434.TPASS_0919 WP_010882362.1.101681 WP_010882362.1.10609 WP_010882362.1.11013 WP_010882362.1.13630 WP_010882362.1.177 WP_010882362.1.22706 WP_010882362.1.24110 WP_010882362.1.24144 WP_010882362.1.26337 WP_010882362.1.26670 WP_010882362.1.28216 WP_010882362.1.31174 WP_010882362.1.34567 WP_010882362.1.35526 WP_010882362.1.35589 WP_010882362.1.37724 WP_010882362.1.38137 WP_010882362.1.38252 WP_010882362.1.38852 WP_010882362.1.39803 WP_010882362.1.41302 WP_010882362.1.42739 WP_010882362.1.42752 WP_010882362.1.43796 WP_010882362.1.44774 WP_010882362.1.45335 WP_010882362.1.49513 WP_010882362.1.50901 WP_010882362.1.51333 WP_010882362.1.6132 WP_010882362.1.61389 WP_010882362.1.63356 WP_010882362.1.72815 WP_010882362.1.73546 WP_010882362.1.74079 WP_010882362.1.78381 WP_010882362.1.79283 WP_010882362.1.82112 WP_010882362.1.89996 WP_010882362.1.90600 WP_010882362.1.90779 WP_010882362.1.92130 WP_010882362.1.96085 WP_010882362.1.98226 WP_010882362.1.98956 WP_010882362.1.99137 WP_010882362.1.99367 gi|378975560|ref|YP_005224170.1| gi|488658348|ref|YP_007936733.1| gi|378982412|ref|YP_005230719.1| gi|378973436|ref|YP_005222042.1| gi|408502768|ref|YP_006870212.1| gi|384422410|ref|YP_005631769.1| gi|15639904|ref|NP_219354.1| gi|189026142|ref|YP_001933914.1| gi|512444360|ref|YP_008119639.1| gi|378974503|ref|YP_005223111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]