SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000000195 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000000195
Domain Number 1 Region: 27-137
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-21
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 565-617
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000706
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000000195   Gene: ENSAMXG00000000189   Transcript: ENSAMXT00000000195
Sequence length 636
Comment pep:known_by_projection scaffold:AstMex102:KB882211.1:1812897:1838874:-1 gene:ENSAMXG00000000189 transcript:ENSAMXT00000000195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGSKNKSQDNAASALLSLQENEKVQDLLGRRCVSLCTAVAQLFMALPHSPFNWSLQHS
GVLCFVKDNPQRSYFIRLYDIKEREKMVQKLYHRKQTEEVEINIFQLFPMQDCQVGLNFA
DEQEAESFYIIVDEKMNQRVHRMENRQSKIRSRVFSDDALPPLPPNGSGNCSPLPLATLS
IQNEPAPTKSKKEKKEKEKKGKKKGSKLSKALIGAPSGFTHVTHMGMDNNSSSMDPDLMK
LFSRAGISEADLNDSETSQMIYDIIERSGGLEAVKKEVNQQDRALPPLPGARQGSLPPPP
PSSASHPSQSRLGPLPPPPGGGPPPPSGGRSGPLPPPPGAASGPPIPGGGRRATLPQVAP
SPSVPRGGALPPVPGGRSGSLPPPPGGQSPSSVPPSRSGPMPPPPGRGSGPLPPPPGGRR
ESLPPMRSGRNDPPPPVPGGRSGPMPPPPGRRSGSLPPPPSQQNDFLPPPPQQSDSFLPP
PPSDILPPPDFDSLPPPPPSDSSYYPPPAAAMAPPPPACASQGGPPPPPPPPPAPVAPPP
SAKPSAPGGPPPPPAASSGGGGGGGRGALLDQIRTGMKLKTVTASTDPPPAAADSEEGIV
GALMMVMQKRSKVIHSSVQIEEDEFDDEEEDDDEWD
Download sequence
Identical sequences W5JXY5
ENSAMXP00000000195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]