SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000000927 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000000927
Domain Number 1 Region: 26-137
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000928
Further Details:      
 
Domain Number 2 Region: 208-280
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.55e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000574
Further Details:      
 
Domain Number 3 Region: 376-487
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.1e-21
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000000927   Gene: ENSAMXG00000000904   Transcript: ENSAMXT00000000927
Sequence length 500
Comment pep:known_by_projection scaffold:AstMex102:KB882100.1:2679360:2702927:1 gene:ENSAMXG00000000904 transcript:ENSAMXT00000000927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMSGHPPQRRVANVGSMLLTPQENECLFSYLGRKCITLCSAVVQVYVADRGPSWTKRCCG
VACLVKDNPQRSYFIRVFDIKDGKPKFEQELYNNFSSSSSRPYFIAFAGDTCQVGLNFAS
EEEAKRFRATLNELLSRRQKKTEKRRDPPNGPTLPMATVDIKNPEINNVRFHNNSHMNNM
VHSSFNKKEKKVKGKRKKLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKILFDMC
GISEAQLKDKETSKVIYDFIEKKGGVEAVKNELRRQGPPRTVVVTIGLPLYPAQSHSSFV
CLPLFPSVTLPLRTEFQVACAAILPVILSIILIIGTLLSGVHTQNRGVGPKGEMGLNPIM
PSVSKLFLPLPAPPPPPPPGPPPPPEMEGSVDSVPSPVGGKSALLEQIREGTQLKKVEQN
NRPVSSTGRDALLDQIRQGIQLKTVSDSSDSGPPTPALSSGIVGALMEVMQKRSKAIHSS
DEDEDDDEDEDFEDDDEWDD
Download sequence
Identical sequences W5K017
ENSAMXP00000000927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]