SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000001677 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000001677
Domain Number 1 Region: 67-179
Classification Level Classification E-value
Superfamily Fibronectin type III 3.38e-26
Family Fibronectin type III 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000001677
Domain Number - Region: 41-79
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00844
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000001677   Gene: ENSAMXG00000001658   Transcript: ENSAMXT00000001677
Sequence length 217
Comment pep:known_by_projection scaffold:AstMex102:KB871963.1:464176:519967:-1 gene:ENSAMXG00000001658 transcript:ENSAMXT00000001677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCIILAINFLHNQCSLSLSFSLSLSLSFSSLYPWFCVCAQVTPMSDRDFGRYNCTARNN
IGARYQEFILAQADVPSNPYSVRLSSVSQRIASVTFMKPDSHGGVPIGHYIVNYKDQSSQ
EWRTVKSHGVQTMVLLTSLEPNTTYEVRVAAVNGKGQGEYSHTEIFQTLPIREPSPPTVH
GQRAVGKAYRLGLVKQDDGGMPIVEYIIKYKTVGIPE
Download sequence
Identical sequences W5K267
ENSAMXP00000001677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]