SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000010986 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000010986
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.09e-23
Family Protein kinases, catalytic subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000010986   Gene: ENSAMXG00000010696   Transcript: ENSAMXT00000010986
Sequence length 171
Comment pep:known_by_projection scaffold:AstMex102:KB877777.1:306:2775:1 gene:ENSAMXG00000010696 transcript:ENSAMXT00000010986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECFLCDFGLSEMLDQTGCSNKTFRGNGLRGTESHMSPEVARGDPRSDKADVWSSCCMLL
HMLSGHQPWTRYYTHPLCLKIVSEPAPLWEIPPGCDPLTCEVIRGGLVKEPRERDSARKL
LEKTTKALQAGEKLLLKVLMLISNYLERMHECQLFVRDISSCDTILQVERI
Download sequence
Identical sequences W5KTS4
XP_007243739.2.101067 ENSAMXP00000010986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]