SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000011278 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000011278
Domain Number 1 Region: 58-251,397-594
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.23e-64
Family Glycerol-3-phosphate transporter 0.061
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000011278
Domain Number - Region: 335-392
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0746
Family Pentapeptide repeats 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000011278   Gene: ENSAMXG00000010978   Transcript: ENSAMXT00000011278
Sequence length 607
Comment pep:known_by_projection scaffold:AstMex102:KB882084.1:699946:707360:1 gene:ENSAMXG00000010978 transcript:ENSAMXT00000011278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKSQQPTTGADLGIRTAKKQQEYRAALEERGKREPQSALKAVVESESMAAGVKRRSAAAA
PDGGWGWMIVAGCFITTICTRAVTRCVSIFFLEFHMHFSSDYSRTAWIHSLVDCTTMLCA
PLGSYIGNRFSCRVAVMVGGLLSSLGLILSSFASSLEYLYLSLGILTGLGFALCYTPAVA
MVGSYFSERKALAYGIAMSGSGIGTFVLAPVVQLLIELYSWRGALLILGGFASHLCVCGA
LMRPLNRHRQNQDGEGREEELSMLNAKLAEANLHMELNLKDNLEMATLDFGGVNIDRVSN
GGLEDKDLVETDTEMMEKTKDIESNPGDTKNTKLNTNLSDTVVVESVLIGSKLPDSMLLQ
LVLSDPGRADSELNSSKLPESMLVHSALTDPMQADLKLMDSKLLKEEYSFLLIPDFLLLS
VSFLFLAFGCSVPFVYLVPYSLSIGVSHQQAALLMSLLGVMGIVGNITFGWISDRRCLRA
YRIVSYLLAVGLEGLGCLFVPLLWNFSLLVPFSLFYGYFDGAYVALLPVVTSDTVGPTYL
SSALGVVYFLHAIPYLISPPIAGWLVDQTGSYTAAFLLCGFSLICSALILTTFKLSHRCS
RGSSHSY
Download sequence
Identical sequences W5KUL6
ENSAMXP00000011278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]