SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000011388 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000011388
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-45
Family Protein kinases, catalytic subunit 0.00000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000011388   Gene: ENSAMXG00000011084   Transcript: ENSAMXT00000011388
Sequence length 211
Comment pep:novel scaffold:AstMex102:KB873613.1:6928:8967:1 gene:ENSAMXG00000011084 transcript:ENSAMXT00000011388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVKIFPGVEFASWKTEHQIFLDAELRHENVLHFLTAEERRTENQYWLITAYHPKGNLQ
DYLRNHLLTWEQMHRLGSSLTRGVAHLHSDQTPCGRPKVAIAHRDLKSTNVLVKDDLTCC
LCDFGLSLRLDSTMSVDELANSGQVGTARYMAPEVLESRINLENIESFKQMDVYAMALVL
WEIVSRCIAIGGTVYTSHYTTATSLCLHLLW
Download sequence
Identical sequences W5KUW8
ENSAMXP00000011380 ENSAMXP00000011388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]