SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000012421 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000012421
Domain Number 1 Region: 127-230
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000802
Family Fibronectin type III 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000012421
Domain Number - Region: 34-120
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00277
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000012421   Gene: ENSAMXG00000012082   Transcript: ENSAMXT00000012421
Sequence length 278
Comment pep:novel scaffold:AstMex102:KB882255.1:984221:998984:-1 gene:ENSAMXG00000012082 transcript:ENSAMXT00000012421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKKKTQSLSGLFSWIFWMCGVCKILGSASSPAPSVTQCELLEHANITCYWTAAGSDST
IYILSVNMTSCLNSTNYKPIGFCTTAHTQCSVSIGSVSHCFCVDVLASSPSGTIRSARHC
LVGVNEVKMYPPQITKLIPIPRKANCLRLEWTEDTSIYLQTKKEHGVLQIEYSTSHQDQA
SRVSTAFHDWKMELCGLYPGTKHYVRVRAQDSRAPKHWSSWSGVREATTAEAAPSATPEL
WRHIQPSDKTGQRHITLLWKVNPKSPDSQALTSTGENK
Download sequence
Identical sequences W5KXV9
ENSAMXP00000012421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]