SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000013326 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000013326
Domain Number 1 Region: 521-707
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.91e-30
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 121-187
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000000445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0003
Further Details:      
 
Domain Number 3 Region: 230-303
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000000484
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00034
Further Details:      
 
Domain Number 4 Region: 5-85
Classification Level Classification E-value
Superfamily Macro domain-like 0.0000000000000387
Family Macro domain 0.0029
Further Details:      
 
Domain Number 5 Region: 424-494
Classification Level Classification E-value
Superfamily WWE domain 0.000000000419
Family WWE domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000013326
Domain Number - Region: 370-416
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0375
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000013326   Gene: ENSAMXG00000012957   Transcript: ENSAMXT00000013326
Sequence length 715
Comment pep:novel scaffold:AstMex102:KB882136.1:2583011:2603638:-1 gene:ENSAMXG00000012957 transcript:ENSAMXT00000013326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGTNSTSKVQSRVKKVLEQCEQNKITTISFPAIGTGAGGIKGVDAMNAMLQAFEGHLSL
QSSSALKHIYVVVDRDEVLQDFQRGLTVWAADIQEDGDEDEDEYIKATNFPEEKEQRASG
SFRHAAELFWDPETGFDLDKLDPELKRLFGECGISETQLKDKGISSVIYEFIVTKGGLEA
VKEGLDKEVKLMKMMKDKEKEKDEKKKEKKKKMLQKKKLTKEAIGTPERFTHVGHASFDL
DTMDPELMNFFSMCGINEAQLKDMETAKVIHDFIEKKGGVEAVMEQFRREASKPSQSNES
NPGPAREPLCLLSEMANISFPAITVEVYGTSTDSLAKVKKLLEELISEECTSKDVQGSYL
SNLKDADKEAIVRLSKENEVHVLVVSSEKLTVSGKKDNVLDAVLNISTIIQEAKDRDTHE
FEKRRLSQTLCWQVAEGDSWVPLDSDISYKLELAFHKKEQVFTYEQEGEVYTVDFKELIR
RNQKRMPCRIRRTLIGDSDTAIIQPPPTWTKMEGEDLQEVVLKKDSEEYKKIETEFLTSS
KRGSSPAVQVLQISRIQNNGLWQRYCVLKKAMDKKYPNQKNEQFLYHGTTQEFSQKINKN
GFNRSFCGRNAVVHGLGTYFAKEAWYSCQDQYSNPDLLGMKHIYRARVVTGSPCKSRGGM
KEPDPLDPNNPQAGLHNCAVDNLQNPFIFVVFCDAGAYPDYLITFRNAEINLSFK
Download sequence
Identical sequences W5L0G4
ENSAMXP00000013326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]