SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000015355 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAMXP00000015355
Domain Number - Region: 22-67
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0186
Family Coiled-coil dimerization domain from cortexillin I 0.0083
Further Details:      
 
Domain Number - Region: 45-107
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0719
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000015355   Gene: ENSAMXG00000014918   Transcript: ENSAMXT00000015355
Sequence length 125
Comment pep:known_by_projection scaffold:AstMex102:KB871939.1:2938857:2976801:1 gene:ENSAMXG00000014918 transcript:ENSAMXT00000015355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEILEMKQQALLAAISEKDANIALLELSASKKKTSQEEVMALKREKDRLMYQLKQQTQS
RMKLIAENYEDGHLHPHHPHHPHHGHPGYTHHRAPPRGPPPHTNHRAPLEQVGGTDVCFA
ITSTF
Download sequence
Identical sequences W5L693
ENSAMXP00000015355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]