SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000016039 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000016039
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-26
Family C-type lectin domain 0.00048
Further Details:      
 
Domain Number 2 Region: 98-165
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000262
Family C-type lectin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000016039   Gene: ENSAMXG00000015590   Transcript: ENSAMXT00000016039
Sequence length 165
Comment pep:novel scaffold:AstMex102:KB882163.1:76036:78596:1 gene:ENSAMXG00000015590 transcript:ENSAMXT00000016039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSITEQSWLESYLYLATSDVWIGLNDLEFSGYFLWSNNHEVTFTYWAPGEPNNHLGFNED
CVEMYQGNGRWNDVTCTELNTFICKMTKGHYPLPSIKPTVYGCPQGWDAFEYSCYWLEET
AMTRAEAKTFCETKDKDSSLLHIGDLYEQAHFTARLASYSGHWWI
Download sequence
Identical sequences W5L877
ENSAMXP00000016039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]