SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000016607 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000016607
Domain Number 1 Region: 149-371,415-465
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.58e-51
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 
Domain Number 2 Region: 580-722
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-20
Family Glycerol-3-phosphate transporter 0.019
Further Details:      
 
Domain Number 3 Region: 488-569
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000562
Family Pentapeptide repeats 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000016607   Gene: ENSAMXG00000016110   Transcript: ENSAMXT00000016607
Sequence length 731
Comment pep:known_by_projection scaffold:AstMex102:KB882163.1:1409329:1441221:-1 gene:ENSAMXG00000016110 transcript:ENSAMXT00000016607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVGRCRMEDPYRERTSLARGARDIAKEAKRHAVKKVNKVVDRASDEYAGRSYNRFENDVE
DDEDRYYYQDGQVQQREEDEGSSDATEGHDDEDEIYEGEYQGVPAEGGVQMAVGRPVVDG
MKDRKELEKEREAEEEELAQQYELIIQECGHGRFQWQLFLVLGLALMSDGVEVFVVGFVL
PSAETDMCVPNSGAGWLGSIVYLGMMVGAFFWGGLSDKVGRRQCLLVCMSVNGFFAFLSS
FVQGYSTFLFCRMLSGFGIGGAVPIVFSYFAEFLAREKRGEHLSWLCMFWMIGGIYASAM
AWAIIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVSAVVSLTFMPESPRFYLEHGKHDEA
WMVLKQIHDTNMRARGEPEKVFTVNRIKIPKQLDELVEMQSESANPAAKVLFRIRSELRG
IWTTFLKCWDYPVKDNTIKLAIVWFSLSFGYYGLSVWFPDVIKHLQADEYASHVKIHRNE
RIEDFTFNFTLENQIHSNGLFLNDRFVSMKFKSVTFKDSTFQNCYFEDVTSLGSFFKNCT
ILDTFFYNTDIDDSKFIDSSVINSTFAHNKTGCQITFDDDYSAYWVYFINFLGTLAVLPG
NIVSALLMDKVGRLSMLGGSMVLSGISCFFLWFGTSESMMIAMLCLYNGLSISAWNSLDV
VTAELYPTDRRGTGFGFCNAMCKLAAVLGNLIFGSLVGITKAIPILLASGVLVCGGLVGL
RLPDTRSNVLM
Download sequence
Identical sequences W5L9U5
ENSAMXP00000016607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]