SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000022156 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000022156
Domain Number 1 Region: 96-325,370-421
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.62e-47
Family LacY-like proton/sugar symporter 0.025
Further Details:      
 
Domain Number 2 Region: 540-680
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.32e-17
Family Glycerol-3-phosphate transporter 0.043
Further Details:      
 
Domain Number 3 Region: 443-524
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000144
Family Pentapeptide repeats 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000022156   Gene: ENSAMXG00000021489   Transcript: ENSAMXT00000022156
Sequence length 686
Comment pep:known_by_projection scaffold:AstMex102:KB882097.1:1278851:1295254:-1 gene:ENSAMXG00000021489 transcript:ENSAMXT00000022156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRYQNNVQGETYPTYGEGGQDGYPYQTDYPPQEEDAASDATEGHDEDDQMYEGEYQGV
PHPDEIKEARRAARREARLKAKLAALEEEESLADQYESIMEDCGHGRFQWTLFTVLGLAL
MADGVECFVVAFALPSAEKDMCLSNANKGLLGLIVYVGMMIGAVLWGGLADKLGRRQCLL
YALAINCIFSFLSSFAQGYGFFLFFRLCSGIGIGGTIPIVYTYYAEFLQMDKRGEHLSWL
CLFWMLGGMYASFTAWGIIPHYGWGFSMGTEFQFHSWRVFVLVCFLPSVVALAGLVFMPE
SPRYLLENARHDEAWMILRQVHDTNWKAKGEPQKVFEVTQIKTPQTQDDDFIEIQSETGT
AFQRFTVRQVALIKQVMKNLMSLAAPDVRLHGLFVGIVWFTMAFSYYGLAVWFPDQIKYL
QFEEYESNVKLFHRERVERFHFNFTLQNQVHREGDYIHDRFVDIEIKNVKFEDSLFENCY
FENIRSTETFFENCTLKNTMFYNTDLWKDSKFIDCKFTNTSFHHPKKGCHLNYQEENDVL
IYLVCFLGSLSVIPGNILAGLLMDKIGRIKIIGGSMLVSSGCTFFLFLCFNPGSVITFQC
LFFAASAAAWNGIEVITVELYPASKRATAFGVLNGLCKLAAIVSTFIFSKFVAVTKIIPI
LLSFSALVCGGLLSFKLPETREVILQ
Download sequence
Identical sequences W5LQ59
XP_007246209.1.101067 ENSAMXP00000022156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]