SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000022199 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000022199
Domain Number 1 Region: 249-512
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-88
Family Protein kinases, catalytic subunit 0.00000000048
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000022199
Domain Number - Region: 81-181
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0772
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000022199   Gene: ENSAMXG00000021556   Transcript: ENSAMXT00000022199
Sequence length 534
Comment pep:known_by_projection scaffold:AstMex102:KB882097.1:1873270:1885789:-1 gene:ENSAMXG00000021556 transcript:ENSAMXT00000022199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDNGDHEDKPPAPPVRMSSTIFSGGGKDHTLLANHSSKPLPSVPEERKPRNKIISIFSG
VEKGGRRKDRDRERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKYEQK
KNPQAVLDVLKFYDSTGNGRQKYLSFSSEKDGFPSGEHSPAKKGTEPPSPNVKSIDDDDD
EDDDEEAPPPVVAPRPEHTKGANTRSVLDPIPPPVCTTDGDVASKAADKQKPKKGKMTDE
EIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKEL
IINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCR
ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWM
APEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLS
PIFRDFLARCLEMDVEKRGSSKELLQHPFLKLAKPLSSLTPLILAAKDAMKNNR
Download sequence
Identical sequences W5LQA2
XP_007246219.1.101067 ENSAMXP00000022199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]