SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000025329 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000025329
Domain Number 1 Region: 146-373,417-466
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-50
Family Glycerol-3-phosphate transporter 0.049
Further Details:      
 
Domain Number 2 Region: 585-730
Classification Level Classification E-value
Superfamily MFS general substrate transporter 8.63e-19
Family Glycerol-3-phosphate transporter 0.07
Further Details:      
 
Domain Number 3 Region: 490-571
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000759
Family Pentapeptide repeats 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000025329   Gene: ENSAMXG00000024624   Transcript: ENSAMXT00000025347
Sequence length 733
Comment pep:known_by_projection scaffold:AstMex102:KB872819.1:3940825:4004027:1 gene:ENSAMXG00000024624 transcript:ENSAMXT00000025347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGYRDRTAFIKGAKDIAKEVKRQAGKKVGRHVDKMSDEYTKRSYTRFEEEDDDDDYPV
QAQDGSYYRSNSRANDDEGAHSDSTEGHDEDDEIYEGEYQGIPRNDSVSKADGQPGGAPH
SQFRDMAQYEGERRKDQEELAQQYETILQECGHGRFQWTLYFVLGLALMADGVEIFVVGF
VLPSAEKDMCLSEPNKGMLGLIVYLGMMVGAFVWGGLADRIGRRQTLLISLSINSVFAFF
SSFVQGYSSFLFCRLLSGVGIGGSIPIVFSYYSEFLAQEKRGEHLSWLCMFWMIGGIYAS
AMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPAVAAIAALNTMPESPRFFLENGKHD
EAWMILKQVHDTNMRAKGYPERVFSVTTIKTVKQMDELVDMGGDATAWHQRWRIKLTNLF
HQVWSNFLTVFNPEYRRTTYMMMAVWFSMSFSYYGLTVWFPDMIKYLQKQEYSSRTKVFI
KEKVEHVTFNFTLENQIHRQGEYFNNKFLNLKMKSMVFEDSLFEECYFEDITSTNTFFKN
CTFIATLFYNTDLFKYRLVNSRLINSTFLHNKEGCLLDFSDENNAYMIYFVSFLGTLAVL
PGNIVSALLMDKIGRLRMLAGSSVISCVSCFFLSFGNSESAMIALLCLFGGISIASWNSL
DVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFQSFVGITKAVPILFASGALAAGSFL
ALKLPETRGQVLQ
Download sequence
Identical sequences W5LR55
XP_007242213.1.101067 ENSAMXP00000025329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]