SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000027199 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000027199
Domain Number 1 Region: 24-134
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-31
Family C-type lectin domain 0.00091
Further Details:      
 
Domain Number 2 Region: 135-241
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-18
Family C-type lectin domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000027199   Gene: ENSAMXG00000026494   Transcript: ENSAMXT00000027220
Sequence length 241
Comment pep:novel scaffold:AstMex102:KB873274.1:15221:15946:1 gene:ENSAMXG00000026494 transcript:ENSAMXT00000027220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAQMKMYVIFLFSILCSFSAGLVRQYFFVDVQINWTSAQQHCRNNYRDLATVSTSEENDI
IRQIAGDKPPASWIGLYRSSDQWLWSDSQAYSFPWWKSDQPNNLNIQNCVVMEDGGWNNN
FCWEKRPFFCEKILVLVKENKTWVEAYEHCRSHYTGLAYLSSDNMDLAKEETQGRQTVSV
WTGLRFLAGHWLWVNGKPLGIEVSLPSCPSPPNRCGALNTLTDPLLWENRDCEEKLNFLC
Y
Download sequence
Identical sequences W5LV24
ENSAMXP00000027199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]