SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000000811 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000000811
Domain Number 1 Region: 610-654
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000263
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 2 Region: 702-741
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000527
Family Ovomucoid domain III-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000000811
Domain Number - Region: 744-776
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00011
Family Ovomucoid domain III-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000000811   Gene: ENSAMXG00000000796   Transcript: ENSAMXT00000000811
Sequence length 959
Comment pep:known_by_projection scaffold:AstMex102:KB871754.1:1002596:1081157:1 gene:ENSAMXG00000000796 transcript:ENSAMXT00000000811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCARSQIVFLLLACNFCALVYAQDPSCCHHAAEFPQCREACDQLAKIRSDSHLRFLYQRL
SSYCSESMTELWICINSTLPGASRKSYGWVGLGCCELAISAECRRECKQASSKNDITKIC
KKDTEKPLYSCITKNEMGSVCCSYAEKQTNCREYCQAIFRTDSSPTSSQISAVKQYCQGT
SPQLIGCVANYTKSYPTRSPIDSLYCCDRAEEAHCQTACKRILRTMTTEHEIMEGLINEC
GSQPLPQDPLWQCFLGSAHPPAKSDPETAPTAKMDCAKLHCCSKANTSLCRKMCQEISTN
WGTQTWQEFDQLCEYNPVETDLITCLADVREPCQLGCKDLTYCTNFNNRPTELFRSCNVQ
SDQGAMNDIKLWSNGTIRMPVMNIPVLDIRKCQPEMWKAVACALQIKPCYSKSRGSVICK
SDCVDILTHCGDFTRFPEGQTPERICDLLSPTDDPERCIPLHRYLTPSPFDNIIEEVIHP
CNPNPCPSNHLCEVNRKGCHAGQDCLPYFCVPGCKLGEASEFLVHMEARIQVPVRSGQAG
CYEVCTCGQSGRLENCVEMPCIDTTQTCVSGEQRKIHGESFKKDCDSCSCYAGETICSSR
KCPSLEHSDDDRHLFRGLPCGCPDHFVPVCARNGRTYPSACVARCVGFQDNQFGYGSCRS
SEPCSPNPCQKNQRCIPKRRVCLTDMTDYPCLQYECVNRPSGCDPNQLDPACDTDNLEHA
NLCLLYQRGKTLAYMGHCQDACRVRQEVCGHNGETYSTVCEAFSDRVAVDYHGVCHAMGA
VSEFMTDSGCNAVPCPPLSTQGCNPVTPPGACCPICAGMLQILWNKKQMNTFAKLNRNQP
ITVHNILRILRLHISVPQCDIFGYLSIDSEIVILIVPVDQQPTPLQIEACSKEAEKIDSL
INSGSPTLVSHVPLSAFLMSELKLSTVSSAAPHSASSLSLLLLCLLLSTLILPFTGRTP
Download sequence
Identical sequences W5JZQ1
XP_007233449.1.101067 ENSAMXP00000000811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]