SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000001195 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000001195
Domain Number 1 Region: 199-278
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 2 Region: 59-123
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000101
Family Eukaryotic type KH-domain (KH-domain type I) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000001195   Gene: ENSAMXG00000001167   Transcript: ENSAMXT00000001195
Sequence length 511
Comment pep:novel scaffold:AstMex102:KB873023.1:1458:14488:1 gene:ENSAMXG00000001167 transcript:ENSAMXT00000001195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAMAAKINAMLMAKGKLKPLQPLPSKVPPCAAQLVSSEEVVVTEVDINDVPVNCRNLL
TKGKTQEEIRLYSGAVVSTKGLYMSDVEKSSSTERPLYLHVQGRTQDEVNKAVLRIKEII
SEDLVRASGGQQPAVMPPLPIYPQPPRPATPAQPLRPHLPSSANPRLPNAPVTPAHRPPP
PHSGSFVHTKIFVGLDQSLPSFNVNEKVEGPSGTYLQHIQTETGARVFLRGKGSGYIEQA
SRRESFEPLYLYISHPNSAGLESAKKLCESLLETVRAEHARMLSMYTATGSTQAYPSQGY
SSSSSYSGQSWYGYPTNGYTSAYPSYPAAGGYWNQASEPSSQTSADTKAPGPAQGMVQYP
VCPRKPSAFLLPDDDSPPGTTTNTSSSSPDSRSPKRRFIEEGEEENKDTENKPYDPVKET
DCRSEGGRSACLCLFRVLMPPPSVLMLPAVRKRPRDTEQPAHSNTGLKEEKDEEEAVEVK
KAKVFTDLSGLVPYGGDSSDEEEESRRKNSA
Download sequence
Identical sequences W5K0T5
ENSAMXP00000001195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]