SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000001765 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000001765
Domain Number 1 Region: 468-768
Classification Level Classification E-value
Superfamily L domain-like 3.91e-45
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 859-1011
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.62e-34
Family Toll/Interleukin receptor TIR domain 0.0000709
Further Details:      
 
Domain Number 3 Region: 46-423
Classification Level Classification E-value
Superfamily L domain-like 3.74e-33
Family Ngr ectodomain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000001765   Gene: ENSAMXG00000001729   Transcript: ENSAMXT00000001765
Sequence length 1034
Comment pep:known_by_projection scaffold:AstMex102:KB871578.1:815372:821649:-1 gene:ENSAMXG00000001729 transcript:ENSAMXT00000001765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTNLWLKLACWLVAVAFLIRHASCKLDEKYLRTQPCDVHENTTDRNVVFYCRGRRLRE
VPKVFSNTTRLDLSENKIKNLTMKDLENLQKLVVLNLNWMNDNHKVNMAPGAFTNLTKLA
QLQLNGVGLTHIPKLPKTLKGLSLVGNKIISLNASSFWHLEGLTALYLSRNCYFWNPCYK
ACEIKNGSFSSLFKLKSLTLSYNNLTYVPRGLPLSLVSLELASNRIAYIGENDFQNLHNL
LVLKIQGNCPRCQNAPFPCVPCPNGSIEIHEHAFDHLQKLTLLQLAGNSIRFLKNGWFSN
LSKLQELFLSFNFLFDAIKDGQFLTHLPLLSKLDLSFNYGMKAYPRTISLAPTFANLTSL
KILHLRALVFKEIDNETLSPLYALQNLSVLDLGTNFLVHTQSDLFSHFQNLKLLYLSENR
LYPVSNSKLPQLGSSSGPTFSLPVLSGSSSIREQTFNIPNQLVKPECFNSGRVLDLSRNN
IFFISPKQFEGHGNISCLNLSRNGFAAAPNGTEFTALPKLKYLDLSFNKIDLAYDNAFKE
LKMLEVLDLSFNAHYFTVPGVTHNLNFLKQLPNLRVLNMSSNSINTLTTKEMHSNSLSEL
QFQHNNLGKLWRENDKTYDNLFTHLKNLTHLDISYNNLNKIPIRVYDCLPGKLKKFRLSH
NGLEGLEWTLLKRFTQLEELILSFNSLVNISQNISQSVPYLRFLDLSKNKISQLTDDFLI
GAVNLQWLDLSNNRLAIINQTTFPSKEYSHLSSLWLHGNPFRCTCDILSFILWMDGTNVK
IPRLATSVMCNMPQSVKGKPVVNFDIRDCIDDQVAFLIYFFTTFFIICITFTTTVMHLFY
WDVSYLFYYMKAKYKGYEYLSSTDNVYDAFVTYDTKDPQVSDWVLNHLRVQLEEQGDRYL
PVCLEERDWVPGSPLLESMTQSIQQSRKTVFVLTQSFVNSGSFKMAVYLAHQRLLEESKD
VIVLLMLEPVLQSSHFLRLRQRLCSQSVLEWPRAPAAEPWFWQCLRNAIRVENCDMYSKI
YSRYFTSRSSSVRD
Download sequence
Identical sequences W5K2F4
ENSAMXP00000001765 XP_007227776.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]