SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000001791 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000001791
Domain Number 1 Region: 419-523
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-23
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 2 Region: 288-417
Classification Level Classification E-value
Superfamily Second domain of FERM 3.24e-16
Family Second domain of FERM 0.0058
Further Details:      
 
Domain Number 3 Region: 68-154
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000559
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000001791   Gene: ENSAMXG00000001751   Transcript: ENSAMXT00000001791
Sequence length 1251
Comment pep:known_by_projection scaffold:AstMex102:KB871578.1:832103:886233:-1 gene:ENSAMXG00000001751 transcript:ENSAMXT00000001791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLTGHRTKASGCPPSSGGWTSSQGPLNGWDMTSSRDGRGDCFIDHVSQSSSLEEVRLG
LDGGDKLVPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDEIIMIN
EEAVSSAPRERVIDLVRSCKEAIVLTVVQPYPSPKSAFISAAKKAKLKSNPVKVRFAEEV
IINGQVPETVKDNSLLFMPNVLKVYLENGQTKSFKFDSNTSIKVSSQSLRHLYLHSGLEH
YSPRPQSHSRNGKAKLRLRYQPHPLLQVTQRPGSHKMKCFFRIAFVPKDPVDLLRRDPVA
FEYLYVQSSERAFQKNSRTLKVSSTKTIRNVRMELALIRSIPGKEEKMLPLLYLSKEWGL
ALFLPPAVLSSMKEKNIKKAITHILKTNQNLVPPGKKLTALQAKVHYLKYLSDLRLYGGR
VFKSTLLQGEKHTEVTLLVGPRHGISHVINTKTNLVALLADFSHVNRIEMYTEDERNVRV
ELHVLDVKPITLIMESSDAMNLVCLTAGYYRLLVDSRRSIFNMAKNSTEVSGHNSREKHN
YQAIDWNYGSCGGCEDHGRGLSDPDSDYDVCGRRDSDVAPIYITELHQSQRAIRGAPMHP
HGHPPPYYTAPRIKPQESPRSAKVSFIFGDPLLDSVNPQNLGYQRLMEDIPEVLDEHRAL
YGQQEDYKPLEPSFDMVDGFQYGAHMVYGDAKIFGTTNGIEEPLLHDICYAETTDDAEDE
DDISCEEDMTMMGELRDKATSLLSLSESSDDIIDLTSLPPPPEGTDEEDCDVLLQSLNLA
IAAPPPGFRDSSDEDEHHGAQAGTRKNQSDIPVSLIDSVPMQVSRGTEEVLDDAVVSTLQ
ALEALAASEDHSHQQSDNSSGVEISRSFSPESASDSGNETNSSEMTESSELAAAQKLSEN
PLKMFVATAEGYQSVSEEKTEFRLTACDARTAPRNEESDCQSGTVPSSQTLRSDHLEMEP
ETMETKSLTDYFNRMHMDAIMGKRQGKVDDGACRVTSLGENEPRHGDIVGKYNNFNAFPP
YQEKSLRSQQILDNKMSEHIYSEFISDTSMSQANLTPQKRNKLESRDMGGTMNLSKPRGP
ATDLNTHSPAEEAYLNEQATTEHQQMKASQAEKEVTRLYEYHLTKRMSSIQSEGIHSLQS
SQCSSIDAGCSTGSSSCVTPMDSPLCTADNVHLLSESSLKGLGYPGAEEKGYSQSPHSSH
NKLLHQNVDPTVLRKHHAPPGAEPLSGTGREGCQRMPKIRETTGMLSSSKP
Download sequence
Identical sequences W5K2I0
ENSAMXP00000001791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]