SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000002415 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000002415
Domain Number 1 Region: 843-1004
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-34
Family Ypt/Rab-GAP domain of gyp1p 0.006
Further Details:      
 
Domain Number 2 Region: 163-208,328-414
Classification Level Classification E-value
Superfamily PH domain-like 4.36e-27
Family Phosphotyrosine-binding domain (PTB) 0.0097
Further Details:      
 
Domain Number 3 Region: 19-156
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-25
Family Phosphotyrosine-binding domain (PTB) 0.0056
Further Details:      
 
Domain Number 4 Region: 1029-1112
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000458
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000002415
Domain Number - Region: 1115-1210
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.068
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000002415   Gene: ENSAMXG00000002349   Transcript: ENSAMXT00000002415
Sequence length 1242
Comment pep:known_by_projection scaffold:AstMex102:KB871578.1:4430837:4505015:-1 gene:ENSAMXG00000002349 transcript:ENSAMXT00000002415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGQDNENKGTSSSSSTAKPDKCFSLWYLGWSSLDRRTTLPMLPWLVAEIRRRGERTEPG
PAQARPVQLSLSPPVIRCVPANSSNTSVFIFEHKAQFISRFIHNSHDLSYFAYLIRSQPE
DPESEMACHVFKAGEPNQVPEVISSIRQASKAALKEDSKPKQEGEEPFYNSQKFEVLYCG
KVMVAHKKAPSTLIDDCIDKFRQHEVERKRQRLLNGQRGSSETVEFIVGDDPLSSSLIEE
AEAEAGDQAKVSNGKLGSSPSVGSLRGAFPECILEDSGFEEQQEFRTRCNSLAGGMQSRS
VQAGAKGPTRRRHASAPNNVQPSDADKNRTMLFQVGRFEVNLISPDSKTVVLEKNFKDIS
SCSQGLKQTDHFGFICREAVESGSSQYLCYVFQCASESLVDEVMLTLKQAFSTAAALQSS
KTQVKLCEACPMHSLHKLCERIEGLYPPRAKLAIQKHLSLLSDNEQADIFERVQRLKPSS
DQEENELVILHLRQLCETKQKTHVHIGEAPQNTSNNTASDTAAGRNKLDVLKNKARSSLT
SSLENIFSRGASRMRMRLGSMGSFDRSFSLILKQDDSPGDSPPGTPPGYLEEDPDAPQFR
RRAHTFSHPPIKKRISFTDAPTQAKAPLRRQHSVAPELLQSSPVNVTRQRSVSEGESSFS
LPSSFSTSTFLKSIYQGSLSSLASLPDSASPKSNGEGRKRTLSGCSSDSLVVVTPRRVSW
RQKIFLRVASPMNKAAASTAGQTDMDGHELLPLSPRALDPRQDALAGLLPSEQSTGGETG
CRTPADYRALWKKAIHQQILLIRMEKENQRLEASRDELHIRKMKLDYQEVGECPKEVQAL
WERKLNVPCRTKVQWDKEEIHTPLCQGVPKGRRGEVWLLLSQQYRLRHRLPQRQQAPDTP
YQDLLKQLTAQQHSILVDLGRTFPTHQYFSTQLGAGQLSLYNLLKAYSLLDTEVGYCQGI
SFVAGILLLHMSEEQAFDTLKFLMYDLGLRRQYRPDMISLQVRALRERKCVFLTHIRDLY
PSLKVSKVSFVMFMHFFFACFLIVFVFCGTDLLFVQGTDVIFKVALCLLSSHEGEILECD
SFECIVDYLKTTIPTLSQNQMEETITKALEMDISKQLHAYEVEYHVLQDEMMDAPQTLSE
DSDRLDKLEKTNAQLKKQNMELLEKLQAARVKIQSLETSVESFLARESQMKHLIRSLEQE
KTSYQKTIERMRSSLPQDSAAEVEMTQLKSGSNGKTKAASKK
Download sequence
Identical sequences W5K4A4
ENSAMXP00000002415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]