SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000002468 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000002468
Domain Number 1 Region: 482-728
Classification Level Classification E-value
Superfamily vWA-like 9.45e-71
Family Trunk domain of Sec23/24 0.0000697
Further Details:      
 
Domain Number 2 Region: 232-499
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.42e-39
Family beta-sandwich domain of Sec23/24 0.006
Further Details:      
 
Domain Number 3 Region: 730-825
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.68e-36
Family beta-sandwich domain of Sec23/24 0.002
Further Details:      
 
Domain Number 4 Region: 932-1073
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.57e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0012
Further Details:      
 
Domain Number 5 Region: 826-931
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.96e-27
Family Helical domain of Sec23/24 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000002468   Gene: ENSAMXG00000002393   Transcript: ENSAMXT00000002468
Sequence length 1077
Comment pep:known_by_projection scaffold:AstMex102:KB882199.1:219654:256996:1 gene:ENSAMXG00000002393 transcript:ENSAMXT00000002468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVTTPPYSQAQPGMGGYPTGFGAPPPQSHYGHYGAPPQSFGAQPAGMLKPAASSP
SGMPPPPVSSQYGSSIQQNGAHPQKFPSPPAVSAPAMTAYGQPPQRPAYPSMTQAAPPMQ
QMTNQMGAMSIGGYGQSPIQSPQSPTSSAASQPFQMPSLPAMGHPPLSPAGLQSPTMSPP
MSTNGSAAPSPFQMSSPPTMGHPPVSPTGFQPPAMSACPPMAAGPPMGAAGAPPMGMPNT
QPGLPPTGGGGFQQQTGPQGFPQQPGPYGGQMPGSQMAGPQAGAFPGGFPGGPANMAGPP
QKKLDPDSIPSTTQVIEDDQAKRGGQLYTTNLRGQVPPLVTTNFTVQDQGNASPRFMRCT
TYSFPCTTDLAKQCQVPLATIIKPFAKVPQNETPLYVVNHGEAGPIRCNRCKAYMCPFML
FIDGGRRYQCAFCNCVNEVPVQYFQHLDHMGRRVDLYERPELSLGSYEFTATLDYCKNNK
PPNPPAYIFMIDVSYNNIKSGLVKLICEELKTLLDRLPKEEGTESSAIRVGFVTYNKILH
FYNVKSALAQPQMMVVSDVAEMFVPLLDGFLVNFQESRAVINNLLDQIPDMFGDTNESET
VFAPVVQAGVEALKAAECSGKLFIFHSSLPTAEAPGKLKNRDDRKLVNTEKEKTLFQPQR
GVYEQLTKDCVGQGCSVDLFVFPNQYMDIATMGNISTHTGGSVYKYSNFQIQVDGEHFLT
DLRRDVERSIGFDAIMRVRTSTGFRATDIFGAIYMNNTTDIEMAAVDCDKAVTVEFKHDD
TLSEESGALIQCALLYTSISGQRRLRIHNLSLNCSSQLSELYKSCETDALINFFAKSAYN
AVLNQPVKTVREILVKQTAHMLACYRKHCASPSAASQLILPDAMKVFPVYMNSLMKSPVL
VGSTELSTDDRAFHRLSVMSLGVEESQILMYPRLIPVHSMDVSSEVVPVAVRCSEERLSE
TGVFLLENGQSLFLWLGQACPPELVQNLFNVPSLAHLSADMTSLPELDNAHSKKLRSIIS
TISQQRPNSMKMVIVKQKDRSEMLFRQYLVEDKGLHGGASYMDFLCYVHREIRQLLT
Download sequence
Identical sequences W5K4F7
XP_007255235.1.101067 XP_007255236.1.101067 ENSAMXP00000002468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]