SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000002785 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000002785
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.4e-68
Family Ephrin receptor ligand binding domain 0.00000145
Further Details:      
 
Domain Number 2 Region: 602-896
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-68
Family Protein kinases, catalytic subunit 0.0000000179
Further Details:      
 
Domain Number 3 Region: 299-464
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-20
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 894-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.39e-19
Family SAM (sterile alpha motif) domain 0.00047
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000002785
Domain Number - Region: 230-301,337-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000561
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000002785   Gene: ENSAMXG00000002680   Transcript: ENSAMXT00000002785
Sequence length 972
Comment pep:novel scaffold:AstMex102:KB882092.1:2221548:2377486:1 gene:ENSAMXG00000002680 transcript:ENSAMXT00000002785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLLNSKESQAELGWTSYPSNGWEEISGVDEKYKPIRTYQVCNVMEPSQNNWLQTGWIWR
QGGQRIFIELQFTLRDCNSIPGVAGSCKETFNLLYAESDWDLGRVAREDRYSKIDTIAAD
ESFTQGDLGERKMKLNTEVREIGHLNRKGFHLAFQDVGACVAIVSVRVYYKRCLSTVQNL
AVFPDTVAEAAFATLVEVRGTCVNNSEVDTDSPPRMHCSAEGEWLVPIGKCSCSAGYEEG
HSSCEACPKGTYKMSSRQQECFPCPGHSVAEEEGSVLCVCEEDHFRTPLDPPSAPCTRPP
SPPRELVYTLKQSTLILEWAAPNDSGGRGDLSYTVGCRRCVGPPRAPQTQCEPCGASVGF
VPQQSGLTERTVTVVNLLPNSNYSFSVEARNGVSELLPNKHFYTQVNVSTSLPAPSQVSE
LRAEKVEQRSVTLAWRESGNPNSSRTEYEIKYYEKTKRPKTHSHRRAGKQHRKMSKSLPA
LRSTFLVLPPFTLPGSTDFHPTSNRARVLERRSKKXSFIVQPSVWHPLSELTLSITDQSV
FILTFMLHDQIIFGKMQCGYSKANQEGDEELYFQFKIPTRRTYIDPETCEDLLQAVHAFA
KELDNSSVKIERIVHTGDFGEVCRGCLKLPSKRELPVAIKTLRAGCSEKQRRSFLSEAGI
LGQFDHANIVRLEGVITRGSTMMIVVESMTNGSLDSFLRKHEGQLSVLQLVDLLSGVASG
MKYLTEMGFVHRRLAAHKVLVNSSLVCKVSGFRPLQDDKIEAVYTTLHGGKSVVLWTAPE
AIQYHRYSSASDVWSFGIVMWEVMSFGERPYWDMGNQDVIKAIEDGFRLPAPLNCPPSLH
QLMLDCWQKERTERPSFTQIHSALSKTIRSPDNIGSSTLTLASSSISLAERTLPSFPSFS
SVGEWLEAVDMGRYKDNFTAAGYCYLESVARMTVQDVLSLGITSLEHQKQMLSAIQTLRA
QVIQMHGRGVQV
Download sequence
Identical sequences W5K5C4
ENSAMXP00000002785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]