SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000002891 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000002891
Domain Number 1 Region: 601-759
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-39
Family SPRY domain 0.00025
Further Details:      
 
Domain Number 2 Region: 318-390
Classification Level Classification E-value
Superfamily RING/U-box 1.79e-21
Family RING finger domain, C3HC4 0.0089
Further Details:      
 
Domain Number 3 Region: 2-71
Classification Level Classification E-value
Superfamily RING/U-box 1.26e-19
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 4 Region: 397-455
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 5 Region: 77-135
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000087
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000002891   Gene: ENSAMXG00000002695   Transcript: ENSAMXT00000002891
Sequence length 759
Comment pep:known_by_projection scaffold:AstMex102:KB871796.1:812418:825617:1 gene:ENSAMXG00000002695 transcript:ENSAMXT00000002891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLSCPICYEVYNDPVVPSCGHSFCRTCLQRSWTLSSERECPICRRRSSREDPPPDLALR
KACESYLQQKKEEGSRSQDVLCFLHSEKLSMFCVDDEKLVCGKCVTQYHQNHSFCSINKA
AKPHKETIQANLRSLVEKLKMFKNAKNIRDKAAAHIKSQFQQTEKQIQEEFKKLHQFLKT
EEKVRLFDLRQEEEEMSQNIKMAIDKLDNQIKDISIRITETQNKLNNDALLMQYTFPVPQ
PNSGALIDVAKHLGNLSYRVGEMMKNFFPNYRSFKVLHKLENAKRKTSKKDFCFYRRFCP
KRVEPPATRSMAASRQSLRKDLSCPVCYDVFNDPVILSCGHSFCKTCIKKCWTQNPGREC
PFCRRRSSKEEPAPDLALRNTCESYLQQKKKEEGSRSQGALCSLHSENLNLFCVDDEKLV
CGKCIAEDHQNHSFCSIGKAADSRKETLQTHLTALEKKLQMFKNVREINDEVAAHIKSQY
LQTEEQIKEEFEKLHQFLRTEEEVRISALRDEEEEKSQRMKRSLDELDKQIKEIRMRIKE
TENKLKDDASFLKDFKTTVLIFRAQYSAPDPKPDSGALIDVAKHLQNLRYRVWERMKSYC
PYYPVVLDPNTANPSLSISANLTSVSTSTEEHQLPDNPERMSGYKGVLGSEGFSSGTHSW
VVDVGGSENWILGVAEESVSRKESCQAIPENGFYTIWRRENEIVAGMSDSGEKIATSPNI
RRICVTFNWDKRQITFSNAENNRALYTFKHKFKKKMYPY
Download sequence
Identical sequences W5K5N0
ENSAMXP00000002891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]