SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000003294 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000003294
Domain Number 1 Region: 13-157
Classification Level Classification E-value
Superfamily PH domain-like 8.88e-24
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 2 Region: 278-378
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000692
Family SH2 domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000003294   Gene: ENSAMXG00000003224   Transcript: ENSAMXT00000003294
Sequence length 410
Comment pep:known_by_projection scaffold:AstMex102:KB882145.1:752720:778283:1 gene:ENSAMXG00000003224 transcript:ENSAMXT00000003294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFSRNQQISLSNMGETPIREDGTVTRSAEYIGSFPIDDCCLDDQIEQLYTQLKRLKSCKR
RRSVSLKFSVKGVKVFNEDETTLLMAHALRRVSLSIARPSDSQFAFVAHNPGSSDTQLYC
HLFKARHARAAQFLNLLLCRCFQLCYLEKHPEDAQNELSGKTPTRVPSLLNHGFPLSVSA
LVSFRRAPTQGLLPGAKESPTPSPTPTSGPDDIFPTSPTLVRKKAIREKVLRSGAYRSFT
CTPLKQRHLQDHLNAPQDKGQDSVPVLRVRAPSLAETEEALAHAVWSWSGVSSDSSSSLL
AEDVLGSYLLCIHPNKPSPGSLIIRFPSGLVTLTVKTHRQKFFLENCHIQFESLPALIDH
YTEFRGELECPLSCARVNHCYEWDENDSKALSQPRSQQSSNRNGKYQCWV
Download sequence
Identical sequences W5K6T3
ENSAMXP00000003294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]