SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000003383 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000003383
Domain Number 1 Region: 211-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000278
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 8-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000577
Family I set domains 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000003383   Gene: ENSAMXG00000003312   Transcript: ENSAMXT00000003383
Sequence length 304
Comment pep:known_by_projection scaffold:AstMex102:KB882299.1:1530836:1602838:-1 gene:ENSAMXG00000003312 transcript:ENSAMXT00000003383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGQNLVTGNVSVIEGETATISCRVKNNDDSVIQLLNPNRQTIYFKDVRPLKDSRFQLVNF
SDNELRVSLSNVTLSDEGRYVCQLYTDPPQEAYADITVLGTPKLLSECIEKYSAFPSKEI
NRLFEFKAAASASASLPPWAKGSNVVTQNKTKKKFKQMTDMTLQTITDWWKLHTRPRAAW
TVCLSTLPPDSAPLIYNDFMQLQKNKPEVKIVVEFPQGPTREGENLELTCKAKGKPQPHQ
INWLKVDDDVPSHAVITGSDLYIENLNKSYNGTYRCVASNLVGEAYDEYILYVYGMYRAT
EPAV
Download sequence
Identical sequences W5K722
ENSAMXP00000003383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]