SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000003589 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000003589
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-65
Family Ephrin receptor ligand binding domain 0.0000026
Further Details:      
 
Domain Number 2 Region: 278-324,373-517
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-32
Family Fibronectin type III 0.0000181
Further Details:      
 
Domain Number 3 Region: 873-949
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.09e-20
Family SAM (sterile alpha motif) domain 0.0002
Further Details:      
 
Domain Number 4 Region: 600-848
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.19e-20
Family Protein kinases, catalytic subunit 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000003589   Gene: ENSAMXG00000003497   Transcript: ENSAMXT00000003589
Sequence length 951
Comment pep:known_by_projection scaffold:AstMex102:KB882145.1:1878827:1944964:1 gene:ENSAMXG00000003497 transcript:ENSAMXT00000003589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDAINEMDEYFSPIHTYQVCNVMSPNQNNWLRTNWIQRNGAHRIYIEIKFTLRDCNSMPG
VLGTCKETFNLYYYEVDRDMGTSMWESQFSKIDTIAADESFTNVDLGVRRLKLNTEIRGV
GPLTKRGFYLAFQDIGACIAVVSVRVYYKKCTGMGRNLAVFTDVVTGADSSSLVEVRGQC
VDHAEERDTPKMYCSAEGEWLVPIGRCVCSAGFEEHRESCIVCYLEIGFIKDISSIHLCG
KILKNIHRKDRSTLIRNQGSRVWRKSEETHSPNCMRSRPSAPITVVHRISKTSVRIQRRK
LEDPDGASRGQYQCSMARCLGTDCGQQRCEPMHVGLTANGNAGVKIQLNGGSGGPIIKPG
AAPIRFIPQQTGLTEPWVNVVNLVAHANYTFRILVMNGVSHLSSEPLPYVLVNITTNQAA
PSQVMAVRQENASINSVILMWSEPEQPNGVILEYDIKYYEKDKELQSYSTLKSKSTSAKV
SGLKPGTSYIFQIRARTSAGCGRFSPSVEIQTGKAXPTGLTVDAVRGSCLKGIFGVLISV
LCMLCYRHCGYSKAFQDSDEEKMHYQNGHVSFPEARFYIDPHTYEDPCQAVHEFAREIEA
SRIKIEKIIGSGEFGEVCYGRMKLPGKRDIPVALKTLKAGYTEKQRRDFLSEASIMAQFD
HPNIIRLEGVVTRIKPRLIKSRQNSMCTSTLLFPPELSVTTINYCGLKPGVSVSLSNICM
SKVLRCLLRKYPKSPVLQVKNDPPYQSPKIKQPNRFLKPKSILHDKATCYSSIQFNLIHY
LLLQRKGQRNSWDPLNRSVIKSVEEGYRLPAPMGCPGALHTLMLDCWQKDRNERPRFCQI
VTVLDKLIRNPENLKSMDTLCRLNSTLMNRSVPDFTSCRSVNEWLDTIKMGRYKNHFAAG
GYQTLGHVMSMNQQDIQRLGVTLMGHQKKIMTSVQVMRAQVLNQSVPSVHV
Download sequence
Identical sequences W5K7M8
ENSAMXP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]