SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000004704 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000004704
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-40
Family IMD domain 0.00018
Further Details:      
 
Domain Number 2 Region: 278-342
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000249
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000004704   Gene: ENSAMXG00000004594   Transcript: ENSAMXT00000004704
Sequence length 530
Comment pep:known_by_projection scaffold:AstMex102:KB882237.1:567187:598131:-1 gene:ENSAMXG00000004594 transcript:ENSAMXT00000004704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGNSDHLHRSTLNIYSNLMEQFNPGLQTLVTLGNNYVKAFQVSRLSNMRVFSVVGEDG
LYVYTGINVQHAGDVLIQISETQRKLTAEVEGLFRWFHVEVLQALDKNVKLDEEYIDGSR
RVYEMEVRNQAAALERQLRRGTYRDSLENSEYMQYLRQSQHEILREEERRYRFLAEKHCG
LTHTLLFLINKTGVSLQQKSEGWKERVNESRSSRPRTPTPLEPDTLLRTSVSSLLQTGDN
LEMYSGKDHQMLGRVPSRAPSPLPSRSRSSSVGESLGLVGGRTMRALVSHPASSNPVLLP
FSNGETLTVLIPEPRNGWLYGRHDASLRQGWFPAAYVAPIEDLQSLSSGGASLRSHSMNN
LLEPTSQSESVDVKSTSEIPLPAPPIRRASADLRPISPAPDRKTEASYETKATQKTYSEI
PPPAPPIRRASGDFRPVSPLIDRRAESHFDSKVEHKGYSQIPPPAPPLPKPADARPVSPL
PEKRAESGYERPKPRGQPPEHPLFPRGSNPFATVKLRPTVTNDRSAPKIH
Download sequence
Identical sequences W5KAU3
ENSAMXP00000004704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]