SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000004756 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000004756
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.33e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000964
Further Details:      
 
Domain Number 2 Region: 178-299
Classification Level Classification E-value
Superfamily E set domains 8.4e-49
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000004756   Gene: ENSAMXG00000004647   Transcript: ENSAMXT00000004756
Sequence length 606
Comment pep:known_by_projection scaffold:AstMex102:KB882154.1:1750391:1767494:1 gene:ENSAMXG00000004647 transcript:ENSAMXT00000004756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPCVQIFEQPKQRGMRFRYKCEGRSAGSIPGEKSSDNNRTYPSIQILNNCRKGKVRVSL
VTKNEPYRPHPHDLVGKDCKDGYYEAEFGPERRVIAFQNLGIQCVRRREVKDAIMQRVNR
GINPYNVPRDQLLLTEEYDLNVVRLCFQVFLQDETGRYSIGLTPVISNPIYDNRAPNTAE
LRICRVNKNSGSVKGGDEIFLLCDKVQKDDIEVRFFNQTWEARGSFSQADVHRQVAIVFR
TPAYYDTSITSPVTVHMQLRRPTDQEVSEPMEFRYLPDDKDPYGCQEKKRKIDSLMKSLS
GFSSGPISSLNRTKAGSHRIKTEPTNFFGKLQSHGIMRQSHQNMMQSTCSSHSMMPSTSA
SPALSAYNPVQWSNPLNFNPASNSPGPSNGVGMQQINTVNPVNAVNTVPTLNTTGESGNS
LPLLSSFDLEILNPQGPSASQPRQEQQDQSVQHAQPAHQPPHRKDAMPAHGGDTMWYNFE
TQGTSGTQNGAQGTGGMMGMGYPYSDSQDGSEMLQSLVGSQLGVHLKQEPQSQSNLTMLG
PANTVTSDCTQVFTLLNYPSANGSGQEAMRQAASGTNMPVQRNTQTPSYSMTGIGNGLNW
PYYPGQ
Download sequence
Identical sequences W5KAZ5
ENSAMXP00000004756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]