SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000004931 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000004931
Domain Number 1 Region: 933-1080
Classification Level Classification E-value
Superfamily C-type lectin-like 8.12e-34
Family C-type lectin domain 0.00056
Further Details:      
 
Domain Number 2 Region: 1081-1214
Classification Level Classification E-value
Superfamily C-type lectin-like 5.97e-33
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 486-622
Classification Level Classification E-value
Superfamily C-type lectin-like 7.82e-33
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 623-772
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-30
Family C-type lectin domain 0.0000803
Further Details:      
 
Domain Number 5 Region: 1213-1351
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-28
Family C-type lectin domain 0.00068
Further Details:      
 
Domain Number 6 Region: 791-920
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-28
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 7 Region: 23-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.15e-23
Family Cysteine rich domain 0.001
Further Details:      
 
Domain Number 8 Region: 215-307
Classification Level Classification E-value
Superfamily C-type lectin-like 7.46e-21
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 9 Region: 348-483
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-19
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 10 Region: 152-209
Classification Level Classification E-value
Superfamily Kringle-like 2.48e-17
Family Fibronectin type II module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000004931   Gene: ENSAMXG00000004651   Transcript: ENSAMXT00000004931
Sequence length 1451
Comment pep:known_by_projection scaffold:AstMex102:KB872739.1:3076:29837:-1 gene:ENSAMXG00000004651 transcript:ENSAMXT00000004931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMKDISNICGFLHLWFFRSTISDGTFLIYNAYKNRCLGHSLQWLDVCDPHSVRQQFRWTS
ENRIFNVVQKKCLGTGSKKEGNTLQWYNCDGNNDLMKWECRTNSLFALMNETLYLSAQDN
SISLILSRDPGEKGKWTRHGTTESVCSRPYEEMYTLQGNSFGRPCQFPFRYKNNWYADCT
KEDSAKKRLWCAIESVYEVNELWGYCPTREKAGDDSWKKNPQTNVNYQVNDQSALTWDQA
RKSCQQQGGDLLSITEPHEQTFISGLIQQTGSVLWTGLNSLDSSRGWHWVNGQPLCYLKW
MSGCPNKVILLPKPTQVSFLLCIKKLGLRCVGGRTGVINSLVIDVLVMPVSWWSFFQSCM
WNEQQRLHLTTLTKKKKPCFFLTLLSDIAYKVLPITEVGQSKEDELWIGFNDLKTSMLFE
WSDHSNVPYALWDMNEPSHDSALKEDCVLLKGEEGKWADQNCQQKYGYICKKKSHLKPST
NDTVVSSPGCKPGWVRYGYYCYQAGSETKTFDEAKQMCEKTGSYLADITNRIENSFLVSL
IGARPEKHFWVGLSNQKDKHTFEWTNTKAKVSFTHFNAGMPGGKQGCVAITTGMLAGLWD
VLSCTNAEKYICKQKAEGVITTAAPPTTPAPSCPSEWNPVPNRDLCYKLFIVNRSKEKTW
SEALAYCREVGGDLLSIHSAHDTQLFKKAQLACFIFRVRTAWIGYSIQDPSAGYTWSDGS
SSSYQAWMEGEPNNFNNVEKCATVNSNWFRGTPEWNDVHCEDKYDWFCEIRKGRVSKDSK
TNDPTQHKSVTPKTEDGWIIYKDNHYYISSFAYESMEGGRKFCKSKHGDLVVINDEEERV
FLWHQIRNAYSGGLYYIGMTIDMDKSLSWMDDSPIVFQAWAQNQPAFANNDENCVGMTNY
QGLWKSMNCGDNAQVICKRSGSAPINATVAPTVPPTGGCAPEWVKIQDKCYKLNLEKKNW
TDARSSCIRVGGNLASVSNSFQQDFLTSKMANEDGIPDLWLGLNSLVSGRFRWTDGSSVT
FTGWSKDEPNSLFKHASYKFGKCVANGGRQRSEPGKWVTKACSELSGYICSRALDRLITP
TPTELPKTFIKLENSSYMFVQTNMTWNEAQKHCTSLGANLASIRDAFTQSYLTVQVHNLN
LPLWIGLNSMETDGYFRWIDNWHLQMERWDHYEPKKDRPCVYMDVNGKWKTALCNQTYYS
VCKQSTDVAPTPPTQFPGRCPEETNGEPKMTWLPYRGHCYAFVTSETSWSVASGICLRRG
GNLVTIQDTNETKFLENYISLFGNDRSDFCIGLFKTHDGHWKWLDNSVVDYTNWEESVNP
DENKQCTVISSRTKQWRPVHCEHNSNMYICKTAKGIVNVTLIFTIILFFFFSAVMRSTVP
SDQPGESRTHAAVVSVVMVILVVAVLGVLAYAYYQKPKTRVASPTVVNPLYYTTETLQSE
EKDTKNLLNNI
Download sequence
Identical sequences W5KBH0
ENSAMXP00000004931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]