SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000006586 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000006586
Domain Number 1 Region: 36-208
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-71
Family Ephrin receptor ligand binding domain 0.00000121
Further Details:      
 
Domain Number 2 Region: 615-895
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-58
Family Protein kinases, catalytic subunit 0.0000000236
Further Details:      
 
Domain Number 3 Region: 334-538
Classification Level Classification E-value
Superfamily Fibronectin type III 2.67e-39
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 4 Region: 909-977
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.47e-16
Family SAM (sterile alpha motif) domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000006586
Domain Number - Region: 265-334,372-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000149
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000006586   Gene: ENSAMXG00000006406   Transcript: ENSAMXT00000006586
Sequence length 990
Comment pep:known_by_projection scaffold:AstMex102:KB882088.1:4429878:4496974:1 gene:ENSAMXG00000006406 transcript:ENSAMXT00000006586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGRMAALSGIIYSVASLLFGVSAGISAPRTYPANEVTLLDSRSVQGELAWVASPTEGGW
EEVSIMDEKNVPIRTYQVCNVMEASQNNWLRTHWIQRGPAQRIYIEIKFTLRDCNSLPGV
TGTCKETFNLYYQETDSDGERTVRESRFSKIDTVAADESFTQVDIGDRIMKLNTEVRDVG
VLTRKGFYLAFQDVGACIALVSVRVFYKRCPLAVRNLAQFPDTVTGADTSSLVEVRGSCV
NHSEEREVPKMYCGADGEWLVPIGNCLCNPGYEERSGQCQVCKVGYYRSLSTDGGCSKCP
LHSYSGREGATSCDCDKTYYRSETDPPATPCTQPPSAPQALISSVNETSVLLEWSPPLST
GGRQDLTYNVVCMQCAWEVTRCVPCADSVRFSPQRLSLRTTRVSVHQLQAHTNYTFQIWA
VNGVSKLNPNPEQAASISLTTNQAAPSTVVSVESKDVTRDTLALFWQEPEKPNGVILEYE
VKYYEKEQNERSYRIVKTTSRSVNIKDLTPLTSYVFHVRARTAAGYGDFSAPLEVMTNSV
PSPVVGEGMSPTVLLLSGGGTIIFLLIVACTFIISKRRAKYSKAKQDEEKHQPGVRVYVD
PFTYEDPNQAIREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKFPGKREICAAIKTLKVG
FTEQQKRDFLSEASVMGQFDHPNIIHLEGVVTKCKPIMIITEYMENGSLDAFLRKNDGRF
TVIQLVGILRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLQDEPEGA
YTTRXWFVIIHLPLDYIPEVYNLLKSKKLINFKSSLFFQSCYFCSTLSLKSSCEVIKAIE
EGYRLPPPMECPVALHQLMLECWLRERSERPKFSQIVNMLDKLIRNPASLKRTGGESSRS
HPSILSHTPSIEPPPSLGSVEEWLKTVGLEKYRENFITAGHSNLESIIHMNQEDFAKLGI
SSSAHQKKLLSGLQEIQAGIQQIQSRKVPV
Download sequence
Identical sequences W5KG74
ENSAMXP00000006586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]