SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000007407 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000007407
Domain Number 1 Region: 929-1076
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-40
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 2 Region: 349-486
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-40
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 3 Region: 787-922
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-37
Family C-type lectin domain 0.00053
Further Details:      
 
Domain Number 4 Region: 1212-1352
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-32
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 5 Region: 639-775
Classification Level Classification E-value
Superfamily C-type lectin-like 7.13e-32
Family C-type lectin domain 0.0000548
Further Details:      
 
Domain Number 6 Region: 219-349
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-31
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 7 Region: 1084-1215
Classification Level Classification E-value
Superfamily C-type lectin-like 7.93e-31
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 8 Region: 21-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.17e-30
Family Cysteine rich domain 0.0000212
Further Details:      
 
Domain Number 9 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-19
Family Fibronectin type II module 0.00077
Further Details:      
 
Domain Number 10 Region: 592-633
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000135
Family C-type lectin domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000007407   Gene: ENSAMXG00000007199   Transcript: ENSAMXT00000007407
Sequence length 1452
Comment pep:known_by_projection scaffold:AstMex102:KB871631.1:831289:870596:-1 gene:ENSAMXG00000007199 transcript:ENSAMXT00000007407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFYDFIHILCLFLPLYPLPTDNSAFLIYNESHNKCVKVVSPNIAQVADCDPSSDAQRFRW
ISSSRILSVSHKLCLGAQDLKEWVRVMLLPCNELSPMQTWECKNETLFGLKTQNLHFNYG
NRHEPNILLYAGTGSWSRWQVYGTKDNLCSRGYQEIFTIGGNAFGSPCQFPFMFGDKWYA
ECTLEGRSDGQPWCATETDYKKSKKWGFCPTQSTSGWDSDPITGVVYQRNTQSVLTWHQA
RKSCQQQGADLLSIVELHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNW
APGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPT
TWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIG
LNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKGKDGKWADHMCEKEHDFI
CKKKASIKPAGSHEVISPGCPANNTHIFYIKMFRIILAILLKIYFSCVDKLLWCLKLIYQ
SRSFTSVVNLSQTDFFLFSLFSDISKCNLNYTIRFFYKKEKSALSMPLDRRQGCVAMQTG
TSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKN
EDKKTWFEARDYCRAVGGDLASFHSEDETNALPIWFLLMGKYGGSSDPAWIGFSSLDTNV
GFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTT
PKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTER
RFIWKQISRGTEDQYYIGMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKS
MGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKS
WHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASDDMWIGLNDVNWEMRFLWTDGKGVT
FTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQI
QVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFN
RFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPKRNLACVYIDTDGTWKTADCSNT
YFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRM
GASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMHRNHEGEWMWIDNMVVDYTNWAPRMP
TAYGDCVEVRSDSGLWYTTRCSGYRAYICKTEKEIMHKASHEAPVTKKVVRNKTSPIVGE
APHGYAGIAVAVVLVIIAVAGLAAFLFFKRPTLPVVGECTFDNTLYFNNPARASNTVDTK
GLVANIEQNERA
Download sequence
Identical sequences W5KIJ5
ENSAMXP00000007407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]