SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000007860 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000007860
Domain Number 1 Region: 26-138
Classification Level Classification E-value
Superfamily PH domain-like 5.38e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000277
Further Details:      
 
Domain Number 2 Region: 232-300,359-376
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.05e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000433
Further Details:      
 
Domain Number 3 Region: 415-476
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000262
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000007860   Gene: ENSAMXG00000007647   Transcript: ENSAMXT00000007860
Sequence length 487
Comment pep:known_by_projection scaffold:AstMex102:KB871688.1:4694636:4705698:-1 gene:ENSAMXG00000007647 transcript:ENSAMXT00000007860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKGKVKGQENMTSSLLNIQENERLVDLLGRRCVSLATAVVQLYMALPHSPAHWSLQHTG
VVCFVKDNPRRSYFIRLYDLKDEKMIWEQELYNQMTYSSPKQYFHTFCADDCQVGLNFAS
EQESDAFRNTVEDKISQRSNRQDKRPASNEEKRAPPPLPPSNGPGPGPGPGQAMQPGGMS
TVDIANPDILPSRYRSPTVPVPAPASLGKGKKDKKGKKKGPRLTKADIGAPSGFKHISHV
GWDPNAGFDTNNLDPDLKKFFSYAGISEDQLTDKETSKVIYDFIEQSGGLDAVKEEMRKQ
DALGPPCRGLPPVPGAPVPPPPRGSLPSIPGQPPPAPPSRNQRTPQRGAVPPPPPGGRAV
PPPPPPPSGGYGSPPPPPSGGAPPPPPPPPPPPPSSASSYSSGSPVSPSAPSPSGGRGAL
LDQIRLGTKLKTVTESSDLPPPPQDEGGEGLVGALMMVMQKRSKVIHSSDDEEEDGGDDE
DDDEWDD
Download sequence
Identical sequences W5KJU8
ENSAMXP00000007860 XP_007231962.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]