SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000007987 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000007987
Domain Number 1 Region: 726-951
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-59
Family DBL homology domain (DH-domain) 0.000000252
Further Details:      
 
Domain Number 2 Region: 325-502
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.97e-45
Family Regulator of G-protein signaling, RGS 0.00000227
Further Details:      
 
Domain Number 3 Region: 958-1086
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0000174
Further Details:      
 
Domain Number 4 Region: 47-126
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-20
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000007987   Gene: ENSAMXG00000007664   Transcript: ENSAMXT00000007987
Sequence length 1442
Comment pep:known_by_projection scaffold:AstMex102:KB882190.1:91967:126460:-1 gene:ENSAMXG00000007664 transcript:ENSAMXT00000007987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVYCPVFSFRLSSLTIGDSERKSSLGQQRESVPELPAESAGNTRLVQRCVVVQRDNLGF
GFTVCGERIKLVQNVRPGGAAVKAGVQEGDRIIKVNGSLVSSMSHQEVVKMIKSGTYVAL
TLQGPPPSVASVPLQPLPSDLLPNHRTSLGGEAPPPPPPPLPATGIGTPSQRITCPKPLQ
DPEVQKHATQILKKMLEQEEAELQALLDEQSKTPSSSLEERIESAKRRANQVRVRIQQDL
DGTRSETLTNYATNVEGQLSIDSAEGDFEACESPFSSPGSSFRIPQHRRQGSDTHTVDSG
GKAHIIGPEEEEEEDGYTINEMDGPFQDIELLKSRPAHMTVFMRYIFSQLLDPNPLLFYL
SVEAYLGSSTKDARSLAPQICSHFLDPDAPLKIKVRDEYLSDIESRLHAQEDIRGPLSEL
QQQVLPDIQDQIQDYRNKQMMGLGSLFGESDLQQLDGDPTKERQVVDRQVTALWELLSKH
EEERRFPLASAVQLYLRHLGIKLRDSKVFPGLTTEKEKWLVFFPKAKKQLSGMKKEKDGE
DKKRNPILKYIGKPRSTSQSTFHIQLSPSSPSSPSEVRSGNVRNIIQQFENHTDTVGEDE
ENEGQRLSTGSLGDDSMDSPTVSVRLARSESLKAQGEGRRRGAGTGSETVPRSRSDVDMD
DCDEREGPGLRPLHHSASSSASSSSARSLENPTPPYTPRSRRRSVDTPLALLPDAPALEE
DVVDFQNWQDTVDPHTLTSLSSREIDRQAVIYELFTTEASHLRTLRVLDQVFFQKMRNVL
TAEELSCIFPNLSQVYELHANLLESMKKQRESPIVQSIGDVMLARFEDAAGEEFQEQVSH
LCSQQSQALELIKSKQRKDPRFAHLIQECEASPLCRRLQLKDLLVSEMQRLTKYPLLLDN
IIKYTEAVSPDLQQLQRAQACCRGILQTVNEVVRETEHRQRLSQYQRRLDSSPLERQANP
VAAQFKNLDLTTKRMIHEGPLTWKVSKDKAIDIQALLLSDLLVLLQRGPDDRLILRCPSR
SLGGGNTDFKSLFCPVVRLDSALVRSVATDNKALYVISTSESQIYELVAGTFSEKNNWKD
LLEKTIVLASAGTGATKQGSPAPHFSVDGSLTKESGSLERDSQSDDDDESVLTPTTPTDK
SGAFLHGEGHDYLQDRAEIAESALRDVDTLRQLIFRDLEDGWSHDSDDTPTNETANERSP
FTDPPGPEMPEPTFTKNTSQLGEDEIDAAKLEVVQPTVQVVRKGTAVGAGSSSIPDDITD
VNSNQPSESKGNMFYLVMPKDQTGALTEESSTDEVKDLSPSEAASQPQEVTLTSSEEEQE
DEDEKTPCRSPNDESHTETLSHETGLSQSRPCRQRHVIKNVDEIFQTIEEMMKKLHQLRE
IEADYYRLLRTARKSPVSEGLDDLIHRNPSVIRTPSMDRGAGDGIEEGSKEPAQPEIHST
GF
Download sequence
Identical sequences W5KK75
ENSAMXP00000007987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]