SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000010469 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000010469
Domain Number 1 Region: 307-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 2 Region: 149-259
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-33
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 3 Region: 475-587
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.02e-28
Family Frizzled cysteine-rich domain 0.00024
Further Details:      
 
Domain Number 4 Region: 263-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000010469   Gene: ENSAMXG00000010190   Transcript: ENSAMXT00000010469
Sequence length 589
Comment pep:known_by_projection scaffold:AstMex102:KB871938.1:2249642:2261413:-1 gene:ENSAMXG00000010190 transcript:ENSAMXT00000010469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPEMSRDDCELYKNVFCNPAFEPETDHVEIQEPIKRPAAKHLSCGDAGYSSILSVCVV
RLRGLWCSWGTLVVSAAVLVLVAVLSLTLALVLTQLNEDSSEEEVLSPLDLWSGVTGPPS
LAPNSTIPHPAMSSVAPQLEQEATTYRKCGGVLTDSEGSISSPNHPGPYPPDSMCVWVIR
VSPPSLVQLHISSLAVEGPSPCLFDWVEIREEREQTTTVSRFCGNVAPPTVNTNSSTVWL
SFRSDSSIGGNGFIAQYHAILPWQKSCSREEFMCDSGRCLLPVSVCDSQPNCQDHTDEAN
CSHKHKECGGQKKGPSGSLSSPNHPKPYPHQQLCTWRISAEEGHVIRLRFQNFSLETQDV
CEFDYVEVHDSANTGDGRVLGRFCGSGLPSDLTSSGPVMTVVFVADEGVADSGFYASYQV
ISLSETSCRAVRFNLVLIQNIALVQLLLKYTFDSVAGTLKSNSDGNTYPIVRASSCEPIE
VEMCQGLSYNLTSFPNIWLTIADQREAAEMLHQYKVLMELACFEPLRKLVCTMFLPQCSL
RGGVLQPCRSVCSAAEQQCSRVLELFSLTWPFNCHLLPDSLDPMECSLP
Download sequence
Identical sequences W5KSA7
ENSAMXP00000010469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]