SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000010478 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000010478
Domain Number 1 Region: 490-600
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-30
Family SH2 domain 0.0000028
Further Details:      
 
Domain Number 2 Region: 170-264
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-28
Family Ras-binding domain, RBD 0.00022
Further Details:      
 
Domain Number 3 Region: 295-409
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-16
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000010478   Gene: ENSAMXG00000010206   Transcript: ENSAMXT00000010478
Sequence length 604
Comment pep:known_by_projection scaffold:AstMex102:KB871927.1:307396:391115:1 gene:ENSAMXG00000010206 transcript:ENSAMXT00000010478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAGCPDYFLHHPNYQDNVDHTPSHGPSGLIRFQQPSNHSSPNHPDDDVDLEALVNDMT
SLSPYESLYSMCKTQHSETAPLLHNGHGSVLQSSRAPQPQRQPSSRAAAPHSPAQNVRRS
QPMHILACMVRRLQEEEHQMRPASLPAIPNPFPELCSPAGSPTLSPGSLPQPEDRHIIKV
FSEDGVGKVVEVPADMTARDVCQLLVYKSHCVDDNCWTLVEHHPLLGLERCLEDHELVVQ
VQASMPPESKFLFRKNYAKYEFFRNPLNFFPEQMVAWCQESNGTIPPSQLLQNFLNSSCC
PEIQGFLYMKETGRKSWKKLYMFLRRSGLYCSTKGTSKEPRHLQLLSDLEESNIFTMTTG
KKMYNAPTDYQFCIKPSKGRTDVKEMKLLCADDEQSRTCWMTAFRVLKYGILLYQNYKIP
HQRKSPITAFTAPVRSVSENSLVAMDFSGRTGRVIDNPEEAVSAAMEEGHTWRKRSQRMN
VLGSASPLHPSSLSSVIHRTQLWFHGRIMREDSHRMIMQQGQVDGLFLLRDSQSNPKAFV
LTLCHHQKIRHFQILPHEEDGHIFFSLDDGSTKFTDLIHLVEFYQLNRGVLPCKLKHPCT
MVAL
Download sequence
Identical sequences W5KSB6
XP_007236661.1.101067 ENSAMXP00000010478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]