SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000010854 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000010854
Domain Number 1 Region: 47-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000105
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 
Domain Number 2 Region: 288-371
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000338
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000010854   Gene: ENSAMXG00000010571   Transcript: ENSAMXT00000010854
Sequence length 425
Comment pep:known_by_projection scaffold:AstMex102:KB871803.1:645879:648811:-1 gene:ENSAMXG00000010571 transcript:ENSAMXT00000010854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEMSVHGVFLLSIWMLCPSLLMSYQAPEDKEDIFTTRACPALLVFESVAYLEDMTIELPC
HCKPEKVLSVVWYYQKYLGMMDTKVLTDFSGTAIVDSSKVGRDLELRNRFSIRLFSLIVF
RVQEGDSGHYVCGTASGEFFYGYDVDIQVVREVLFPWNLVPLKQKQASEAKENVNTPFQV
FTSYWPWSLCDRCGVKGEQTRVGLCYVMSQHLQVRYLRQSSNVTSCGSSAVPLRFGLANS
HHRAELVVRSCHTPCPKKATTVSPERKGLLDFLGYGDPESPGLSVHYHNHPVGSDLVLSC
PGMKPQHAVAWDKGSTPLYRSEFMEGLKKSSRMFIDVGHHLHIRLVHLKDKGSYFCWIQG
KKAAEIKLGVYSRVGRMRRISDPEALFILKNILKVYALLTAVFLLIISLCICLTFLTQCI
PHFST
Download sequence
Identical sequences W5KTE2
ENSAMXP00000010854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]