SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000010952 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000010952
Domain Number 1 Region: 77-281
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-37
Family DBL homology domain (DH-domain) 0.00095
Further Details:      
 
Domain Number 2 Region: 314-501
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.2e-22
Family BAR domain 0.017
Further Details:      
 
Domain Number 3 Region: 647-728
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-19
Family SH3-domain 0.00072
Further Details:      
 
Domain Number 4 Region: 559-628
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000486
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000010952   Gene: ENSAMXG00000010660   Transcript: ENSAMXT00000010952
Sequence length 733
Comment pep:known_by_projection scaffold:AstMex102:KB882099.1:1083724:1116040:1 gene:ENSAMXG00000010660 transcript:ENSAMXT00000010952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHILRTNRSPAESLRRHGTPEEFTKEVKEVAGQVRGPRTVVEMVGEMDGLAEDLAEEED
EEAERQKKAAAEQAAARERAAQRQLMAIQELEETEKNYLKHLQICTVTIRSNLEKIQPPL
ANLDGMFQHIDEVMEVSGRFLSLLHQAHMKPSDPQYLETLCTSFLTLSRDIETAYKEYLA
NYNNITAIENGYKQKEVLWMEMVKVIKSSAPEVNASTLSFFLVMPVQRIARYPLLLQTIQ
KHTDPQHPAYVLLEETAHTAVQLNCRINEYKRFREVADKYKKTENLTIKDKINRLSGHSI
AKKTARLSQYIKHETGMIPKMKDEEFDSLVGFFFVLEKGIIELHDNMEAYLIHLQRFLSC
KPEEADLDLEGEKTALFSKEITVALRQWIYPAYEARLKTLVFKPLSSLRELMTGPRNLIR
KRQDKLLDFEMIEEKSNLSYDEQAVANTYKTMNTLLLTELPQFNGKALQLLWTTLGAFSC
LQRDLSADMEQLATSFTHQLPHSYLDSSAFWEWAEGSVLEEARKLEALCQSVQDELNAPI
VQVSVVSEKRLKLLTDRHSSDKIYQLTGPVVATRDLDLTLNKGELVAVIREMDTRGDRRR
WLVDAGGPRGYVPASKLTRYHHVTADPPPQSPYLMASSSGPGPRRHSYSPGAQPVVSMAL
PCFQVFAGYDFTARSSHEISLRAGEPVRVVEPHDKRGNSEWSLVEARGQRGYVPSNYLAM
LPSVVASPTMPYH
Download sequence
Identical sequences W5KTP0
ENSAMXP00000010952 XP_007246472.1.101067 XP_007246473.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]