SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000012054 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000012054
Domain Number 1 Region: 227-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000684
Family Eukaryotic type KH-domain (KH-domain type I) 0.0053
Further Details:      
 
Domain Number 2 Region: 108-173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000074
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000012054   Gene: ENSAMXG00000011673   Transcript: ENSAMXT00000012054
Sequence length 593
Comment pep:known_by_projection scaffold:AstMex102:KB882226.1:720603:727686:1 gene:ENSAMXG00000011673 transcript:ENSAMXT00000012054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICINLLYFCLSLFRRRSKWDQPGPGPGVEGDAAPTGALDAAAAVAAKINAMLVAKGKLKP
SQIGTPGTVDKTTGSGGKSMPVAKAKDDLVVAEVEINDVPLTCRNLLTRGQTQDEISRVS
GAAVSTRGRYMTAEEKAKAMPSDRPLYLHVQGQTRELVDKAVNRIKELITNGVVKAATSS
STSYNGATVTVYHPPGPPPATLPPAGHKPHFTGGMHYVQDKLFVGLEHAIQGFSVKERVE
GPGCSFLQHIQAETGAKVFLRGRGSGCLEPASGREAFEPMYIYISHPKPEGLAAAKTLCE
NLLQTVHAEYSRYLTQMSAVMPTQGFIQPPAVNGIAPQAPYYTPAGFQPTYPPPVPPPQP
IPAPYTLPLPAVAPGTQTPIPPPSAQYPIAPAPANLPPQNLQPATFPLVAPALPKPAASA
AQTPAPQKRRFTEEVPDETESGLLGYQHGPIHMTNLGAGFTVGSAEASGPPLAGPCGPPQ
ERDSRQLMPPPALPVNTVVRALKTEERRTLPALLAQSPTEPQVKRMKTGLVAYSGDSSDE
EEDHSSLKLGGSGNMGPGSSPPGWPAGAYRCPTPPPPRPKTQTSQPMPFWMAP
Download sequence
Identical sequences W5KWU2
ENSAMXP00000012054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]