SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000012753 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000012753
Domain Number 1 Region: 373-451
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.14e-19
Family Intermediate filament protein, coiled coil region 0.00054
Further Details:      
 
Domain Number 2 Region: 135-171
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000157
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Domain Number 3 Region: 187-281
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000288
Family Myosin rod fragments 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000012753
Domain Number - Region: 316-395
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000012753   Gene: ENSAMXG00000012395   Transcript: ENSAMXT00000012753
Sequence length 494
Comment pep:known_by_projection scaffold:AstMex102:KB871606.1:1107363:1119832:-1 gene:ENSAMXG00000012395 transcript:ENSAMXT00000012753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMSMSLSSSRLSGYSGGGFSRGAGGAGARLGLGLGGGAGAGLGLGLGLGGGAGAGFGYG
LGGGAGAGAGFGYGSGGGAGAGFGFGAGGAGGALVASPAFAMGRTIAAGGLSAGSALAAG
SALCVSVAPILSREAEKSTLSNLNDRFSTYMAKVRALQQENAALEAKLSQLTGGADMSPE
ASSTTTVEYEAQLSEYRSTLQTLTLDTIKLEIELDNVRGAAHEVKAKLDFEQGVKFQLES
DIASMKKDIEAASDLRIDLDAKYASLKSELDFVTKTQEEELSSLQSKLGTSTMDTSVSMI
EVDTGKSFDISAALNKMRMEYEKSVQQNREEAEAYYKIKMDEIQTANAKSTEAVSVVKTE
VTSARKELQALGIELQGLITQNVTLEQSLAEASAQSSVGVAEYQAQIASLTSAIEAAKVD
LQKQMLAYQELLDVKLALDVEISTYRKLLEGDDFKMPDYTETSYTFSAGGKIQVKEIITE
HTETSVISDDGESS
Download sequence
Identical sequences W5KYU1
XP_007229380.1.101067 ENSAMXP00000012753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]