SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000013164 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000013164
Domain Number 1 Region: 1935-2232
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000145
Further Details:      
 
Domain Number 2 Region: 502-610
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-32
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 3 Region: 611-719
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-26
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 4 Region: 1084-1191
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-26
Family PDZ domain 0.00057
Further Details:      
 
Domain Number 5 Region: 862-963
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-23
Family PDZ domain 0.01
Further Details:      
 
Domain Number 6 Region: 1234-1337
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.042
Further Details:      
 
Domain Number 7 Region: 415-501
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.4e-20
Family First domain of FERM 0.01
Further Details:      
 
Domain Number 8 Region: 1643-1738
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-20
Family PDZ domain 0.038
Further Details:      
 
Domain Number 9 Region: 1545-1637
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-17
Family PDZ domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000013164   Gene: ENSAMXG00000012780   Transcript: ENSAMXT00000013164
Sequence length 2245
Comment pep:known_by_projection scaffold:AstMex102:KB882125.1:2945471:2997797:1 gene:ENSAMXG00000012780 transcript:ENSAMXT00000013164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVIVYSLGMTLYWSVDYHLPQNQPIPLSDSLNCLLLSMCEDMAHRRVNLNTILESCESHH
KTSLLPPPNKVIRQLVEDVFHDTGDRSTLTDNTVHLSGRSQMIRERLHGNPCTHSMDMVS
FKPHPAKYRLSSTLRMGEHHYVIICCTPDSTGKQGVYHGYTEGSGAAAERQRRLSLDSEP
KQGGFHQQKTWSLKNRSSQMPTYQGIQSRRDRIPQGAHHSGRNSSWLSQSTYLHVPCKGE
QRHRSPSVSVSESTLNLAHRRAKSLGPEFARMVDEPQIVLELPGSIVVNIFFSKQFTAKN
RDALKYLIKYCIKSKFCCFSKNTTINYNKKYLLNTFELCRRHTNMQITISFKINKQKKKN
DIKNYLKKLKCHFNPHNFSCRIFDWPSFLNYAFCCFLSSCSLIQSKKGKSCLSQREVSVV
MPNEQCVTVRCDIKSRGRDVFDMVVAHANLVEHFYFGLAFLDDDEFFFLDHETKISKVAP
DTWKKLATSPFTLFLRVKFFADDVTFILHKLTRHQYYLQLRRDILEDRVHCNEDTAVYLA
ALALQAEFGDYMDEVYGRNYFQTEHYIPKRVMEKIALPCLREELPRLHANNAQMLPEEAE
MEFLKIAQQLPEYGVLFHRVARERKPVIGDLTLGVCAKGIMVYEVKNNSRTLIRRFQWSE
TDNISTTRRKFTIECSPSGKKHSFLTESSKIAQYLLSLCSAQHKFHSEMTSRQLTTLASG
TTFTVLFGILLLNTMINDNIAKYSLCRARHSQIKRLSCSEMVLNNVGLNHGPMDSMSKSC
DDLSAKIQQQREANDTPEPRALSELRKPSQSCSPPETFGSPIYRIASNMSLQKQDSEPHS
ISSMRGKELVTQLILVKLVFLTADTPVRTPPEREIICVTLKKDPKLGFGFIIVGEDNTGK
LDLGIFIASVVPDGPADKDGRIRPGGRLISLNKISLEGVTFSAAAAILQNSPDEVEIIVS
QPKHYFTDFYLILVWIVLWHYNCTLCMFRVQSLLRAEELGDSKTSLTTGNLSMMLERGFD
SQSTLSAEYRPVMEELEEALSNIMTPKTGRKLHIPVVRILDTQLRRLCLNENEKYLFSAL
LQETFSRSSSSSSLRPGELLGVELRKVNGSLGISVAGGINTNIRYGGIYIKSLIPGGAAD
QDGRIQTGDRLLEVDSCNLRSVTHRQAVECLKKTGEVVSLLLEREPPVVLETCSSSSTME
RQKSHSPFSAQSTTTTPLRREITMETSLSVRGKDYSFVSDANTLEVTLKKSPKGLGFSFL
ITDLRHEGGSVVRIRRLFPGQPAEQCGLLRQGDVILAVNGEPLRGLYYQQQRVLQLLQGA
PPEVKLTICRPLPGQLPDMETNSLDKTPSTPSSPSSPPSPDEEPQKKVLLNIAPPPTPAV
VTLTTPNPVPDTPKESPKLLVSQPELKEDIPSRINSSAFNTRYQSILCVCGTSIVSHDFC
HVTLTKNAKSLPLRLAILADEEYLTITTTVPSPPSYSTASSKIRSPPVSLTLPALLPLPV
LPPPSPPKTTLITAQSPTSAAQPTSDPQASTNNGWDDEDFIAHTDDVMKEFELTVTLSKS
WSGSFGFTVTRSKLDGCYYIQDILDNPAKSDGRLRPGDRLIMVNGHNVTNVTDEVAMRIL
RYSSKRLHMVLGRAVQNLLPPPPPDSLQDIIIYKTPSGQMGIKLTGGIGSKWQGIYVQEV
VPNSPASEEGSIQPNDRIVYISGKCTLGMTLEDAVKACENASRKVKLKAMRDDQPVTPKG
KWNVVSYFFSREEYCVTQIKVVDILRKAEGTVQLTVCRDILPATIRSDSNSSAEANQEHS
ASCTTSPPHSREHTNTNISSQVLTFYCTLLYINNSILNLNSKSIFIIKLCLNIYVEKSQE
NQPCMIKDPPEHSNVVKVSAQTDPQKQPLENLTTNMEQSHSDGWSSDDDDDDEDEDTARP
SPLETMPHTGQPIVSEVELTSLALISPPKNSQYSGARLKALIQILQNQLDQQELVKEFMA
LEHLKPLDNCLVGKAPENREKNRYRDILPYDETRVPVGERQDYINASYIRMKVGTEEFFY
ISSQGPLPSTQDCFWQMVWENKSDVIAMMTKEVERGRVKCHKYWPEKLHVPMETGHYQLI
LDNYQIQDYFHIKVIRMVEKETGATHFVKHLKFTTWPDHGTPHSSKQLVRFIRYMRAVHS
NGPITVHCSAGIGRAGVLICTDVILSLIEKDLTINVSEIVREMRLQRYGMIQTKEQYLFC
YKVWLEVLQSILLLHGNQWQSETPS
Download sequence
Identical sequences W5L002
ENSAMXP00000013164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]