SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000014963 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000014963
Domain Number 1 Region: 810-1014
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-47
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 1048-1245
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-45
Family BAR domain 0.001
Further Details:      
 
Domain Number 3 Region: 250-326
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1544-1607
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.0000928
Further Details:      
 
Domain Number 5 Region: 1311-1390
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000106
Family SH3-domain 0.0000128
Further Details:      
 
Domain Number 6 Region: 145-208
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.001
Further Details:      
 
Domain Number 7 Region: 4-65
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000866
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 8 Region: 63-136
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000499
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000014963   Gene: ENSAMXG00000014385   Transcript: ENSAMXT00000014963
Sequence length 1611
Comment pep:known_by_projection scaffold:AstMex102:KB882270.1:3913160:3961937:1 gene:ENSAMXG00000014385 transcript:ENSAMXT00000014963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRALFEFLPSVSEELPLFAGDVVEVLSVVDEFWLLGIKDGVTGQFPSTFVESIT
VPPTKPGEQLYVCINDFSSVEPGNLPLKRGDVVAGEARVDAVWQRGRNAWGSWGLFPVSC
VKQLELSGRSRQLSERSAAAQASELPPHALGQARALMGLHAQLDEELDFREGDVITIVGI
PEPGWFQGELEGRTGVFPEGFVELLTPLRSIQQEPELQGTGQYLQSRMEEEEEEEDEDED
EGEEEDEETGGVYGVALYEFRALEPGELDFNVGDKIRILGTLEDGWLEGELRGQIGIFPH
RFVKVNEPLQTVPQEQPMDIETSTPDKVEGDSYLSDCSSGQQDHTVLENEQTCETHEDHT
VWDLDYFEQREESKETLMRETQPKNNAQDRAVAQRQPQTQPKRRERPPPPLIQPNQSGNS
AHKAVQRTNSGSPTPPRPQLPPRPSLHALNNRQQSMGARSSPHEPLPVPTTRSQSLHPPG
RSSPSLQTNLSWSRNKGHYASHDSRNPFSSRISSNQLGKNREKKLTRHASVNDSDLSSCG
GLTEKQAWPKGRAPNGLSASHTLDSLATCVGDLESKLSQQLLEFEKSLPGRGGAAIQVSR
HFSILDYSNENDIIRGSSLHRSTSSLERQKTLRPPPPRPRILRPPVPPSSHAHAPLTNGR
AAPQPYRPARRAPRPPPPCPRPNSDLHRTPPKTSALLFPAEREREMEQEREREMEQERER
EMEQYKLLLRLEEVERDIDMYTNTVQELHAMLDEEDQEDETARQQAMENLEFCTYTLETL
TLEQQQLREMTLLSAQPKSVDSAPASAASTEDPEQRMLEKRSKVIEELLQTEADYIKDLR
MCRKEIIEPLRKRQVQNIDFDGLFGNIDSVIHLSQRLNETLQDTDSIGQVFLDFKSELEE
VYKVYCQNHDDAISLLETYEKDESIQKHVLECLENLRAIYRGWGKTNYINLGSFLIKPVQ
RVMRYPLLLMELLNATPQSHHDRKQLEDAVLSVKEINGNINEYKRRKDLVVKYRKGDEDR
LIDKISKLSMHSIIKKSNRVSSHLKHLTGISPQIKDEAFDDAEKRFRLQERLIKSFIRDI
SLYLQHIRESASVKVLSAISFCDIYTERQQQLDPERFQRAHRCISDKQFTQFKERTETLV
ISPLTQLLSMFAGPHKLIQKRFDKLLDYDNCKERADRLKDKRVQEELQVARNNYEALNAQ
LLDELPKFHYAAEELFTSCVRGFAQAQKDFIRLTLGELTPLLQLSGLGGTEGTLVSLFQE
EHGRVLQLLQSFSFFPENLPTSRKPFEKKTLEKQTSKKHMQGPPNYVLQTDDHRAGLLAR
YGPEKLFQAERNFNAAQDLDVSILEGDIVGVIKQQDPMGSQNRWLIDNGATKGFVYSSFL
KPYNPRRSQSDVSIESQSSNESGYGGSSPVFSRQNSNSTLTFNQETSTVSFSTAAPSTHT
SPRPTQDSTLTRRNPHRDTPTSNCPPTNDKDSSGSNYTTPPSRRDLSDSSETDSCSSTWK
SRHEQSQRYTASSSQQRKNGDYSLQTRKPHYPADTEHIEPDPDPELDGHQIYYALYSFSA
RCANELSISANQKVRILEFQDMNGNQEWWLGEAGGKRGYIPSNYIRRSEYT
Download sequence
Identical sequences W5L551
ENSAMXP00000014963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]