SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000015319 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000015319
Domain Number 1 Region: 194-316
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 4.97e-51
Family Dystroglycan, domain 2 0.00000382
Further Details:      
 
Domain Number 2 Region: 472-573
Classification Level Classification E-value
Superfamily Cadherin-like 9.1e-18
Family Dystroglycan, N-terminal domain 0.018
Further Details:      
 
Domain Number 3 Region: 60-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000121
Family Dystroglycan, N-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000015319   Gene: ENSAMXG00000014885   Transcript: ENSAMXT00000015319
Sequence length 876
Comment pep:known_by_projection scaffold:AstMex102:KB871939.1:2396871:2408145:1 gene:ENSAMXG00000014885 transcript:ENSAMXT00000015319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRVFIIRSVGVSMWGLLLLCAVTWASEPIIVELEASMHSTLLLDIQSSVSRVATAQSS
GVSDTVAVVGQMFWMRIPLPSADCHSTDIFSEVGSAPFPSWLYWDNELCLLQGLPLEGDK
GLYRFSLSPAALQGRDGSIQSHLLLRGTKLNSAYTHINQPEVFTITVNSEDQQEIDPAPL
TRHTEINATAVCVCSSGQPITVLTIILDADLIKMNSRERLALLQKMSHFASVPPELMRVM
PVINNRFFDMTAFMAGPGNAKKVVENGALLSWKLGCALDQSNLPDISRVQLPAKDGTMSA
LLGYPVVGWYIVNKKPQVVKRIRRQIHNTPTPVPSQLPPTTHPEPAERIVPTLTSPFIAP
TTDMLANPARGPLPLPVKPTIRIRDQVAYTPVLGHPLPTRVLGSTSTLPIQPTLTRHGYV
EPTASVTPPTTRRPKTSATKKGKKQKTTPMPREPKTTVKPSRRTTPVTNQKPQLHNPIDE
VNVWVGTYFEVKIPADTFFDQEDGSTERLRLSLRQSHNQAVDEGSWIQFNSTSQLLYGLP
DLSHVGRHEFFMMATDKEDTSTTDAFEVHVNRWPAEDQSPVTFTARFQGEPSALSGDIHK
KILLSKKLAFALGDRNSSSVTLRNISNGSILVEWTNSSLPKNPCPREQIQAMCRRISDAQ
GQPTPIFNSAMEPEFKPINISVHGANKCQRFSFVPPGELPIPPSTGESPTLVPTSVTPSS
GSGRRSSDDVYLHTVIPAVVVAALLLTAGFIAMVCYRKKRRGKLTTEEQATFIKKGVPII
FADELDDAKSPPSSSMPLILREEKPPLPPPQYPSSACGEGSLLNHHMLEEYISLSDDDPS
APPYQPPPPFTVPIEGKGSRPKNMTSYRCPPPYVPP
Download sequence
Identical sequences W5L657
XP_007237047.1.101067 XP_007237048.1.101067 XP_007237049.1.101067 ENSAMXP00000015319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]