SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000016822 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000016822
Domain Number 1 Region: 154-329
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-33
Family Phosphotyrosine-binding domain (PTB) 0.00000365
Further Details:      
 
Domain Number 2 Region: 469-568
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-27
Family SH2 domain 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000016822   Gene: ENSAMXG00000016334   Transcript: ENSAMXT00000016822
Sequence length 575
Comment pep:known_by_projection scaffold:AstMex102:KB882208.1:1482386:1506350:-1 gene:ENSAMXG00000016334 transcript:ENSAMXT00000016822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVPKTKYAPFRSDSFSSTDETASNPSLPSSAPLTPLTPPGIPSSLSSSSLAPILPPTS
SPRATENSPTTLCSFFPRMGSLRLGMSATLRPSLKATSRPEHVAGPCELQEAPAASTPGA
SLLSLTAPSPPPRPTQDMNRLGGASRRARVEGGQLGGDEWTRHGSFVNKPTRGWLHSDNV
VSSTGVSYTVRTVRHTRLYAPLFYTSKKQVCRHVFFPSNSHVKPAAKMNPSSSVWWFDGL
GSSIFLLIIFQRFSICVVDSKKIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACH
ILECSEGLAQEVISTIGQAFELRFKQYLKNPPKLVTPHDRMAPFDGSAWEEEEEDLAPPP
DVPYYNNFPGKQPPPGGLVDMRTRPGHSTGATLPFGQPGMNDIHKQPLPPLPVGGKDGGL
FDDPSYVNVDKPRPPVTAANGNAHRDVFDMKPFDDALGATTPAAVTAAPPLAEQLQNEPW
FHGPLSRRQAERLLSKDGDFLVRESGTTPGQYVLTGQQGGQPKHLLLVDPEGVVRTKDHR
FESVSHLISYHMDNRLPIVSAGSEVCLQQPVDRRA
Download sequence
Identical sequences W5LAG0
ENSAMXP00000016822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]