SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000017565 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000017565
Domain Number 1 Region: 116-186,233-300
Classification Level Classification E-value
Superfamily Immunoglobulin 5.74e-19
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 26-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000119
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000017565   Gene: ENSAMXG00000017059   Transcript: ENSAMXT00000017565
Sequence length 301
Comment pep:known_by_projection scaffold:AstMex102:KB871976.1:217333:255759:-1 gene:ENSAMXG00000017059 transcript:ENSAMXT00000017565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRYTHHLPLLLSFVLAGPDSVQAAEFGHLPDNLTVLEGESVILRCKIDEEVTHKAWLNRS
NILFAGTDKWSLDPRVSLVNSNDSDFSIQIEQVAVADEGPYTCSFQALNQPRIAHVYLIV
QVPAKIVNISQDKSVNEGDDVNLFCLAVGRPEPTITWKDFKYGRMYEGEFLDITDIKRHQ
AEEFECITNNGVAPPDTRRVKVTVNCRRRSPPLKRTLISTRPAPDLHTDTVQCKTRLLPI
TSYAPQHQEGRPVENDNTLKIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLL
F
Download sequence
Identical sequences W5LCK3
ENSAMXP00000017565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]